BLASTX nr result
ID: Akebia25_contig00012665
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00012665 (632 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU42104.1| hypothetical protein MIMGU_mgv1a025113mg, partial... 69 1e-09 ref|XP_006591462.1| PREDICTED: OTU domain-containing protein At3... 69 2e-09 ref|XP_006591461.1| PREDICTED: OTU domain-containing protein At3... 69 2e-09 ref|XP_006591460.1| PREDICTED: OTU domain-containing protein At3... 69 2e-09 ref|XP_006402837.1| hypothetical protein EUTSA_v10006116mg [Eutr... 68 2e-09 ref|XP_007163740.1| hypothetical protein PHAVU_001G260200g [Phas... 67 4e-09 ref|XP_007163739.1| hypothetical protein PHAVU_001G260200g [Phas... 67 4e-09 ref|XP_006659568.1| PREDICTED: OTU domain-containing protein At3... 67 6e-09 ref|XP_006850126.1| hypothetical protein AMTR_s00022p00229870 [A... 67 6e-09 gb|EMT22953.1| hypothetical protein F775_07831 [Aegilops tauschii] 67 6e-09 gb|EMS56573.1| hypothetical protein TRIUR3_04599 [Triticum urartu] 67 6e-09 ref|XP_003632695.1| PREDICTED: OTU domain-containing protein At3... 67 6e-09 emb|CBI29898.3| unnamed protein product [Vitis vinifera] 67 6e-09 emb|CAN60311.1| hypothetical protein VITISV_002512 [Vitis vinifera] 67 6e-09 ref|XP_004291162.1| PREDICTED: OTU domain-containing protein At3... 66 8e-09 tpg|DAA40387.1| TPA: hypothetical protein ZEAMMB73_782196, parti... 66 8e-09 ref|XP_002266448.1| PREDICTED: OTU domain-containing protein At3... 66 8e-09 ref|XP_002514949.1| OTU domain-containing protein 6B, putative [... 66 8e-09 ref|NP_001132051.1| hypothetical protein [Zea mays] gi|194693302... 66 8e-09 ref|XP_006379934.1| hypothetical protein POPTR_0008s17740g [Popu... 66 1e-08 >gb|EYU42104.1| hypothetical protein MIMGU_mgv1a025113mg, partial [Mimulus guttatus] Length = 147 Score = 68.9 bits (167), Expect = 1e-09 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -2 Query: 631 FLEGDFDTYVTQMRHPHIWGGEPELLMSSHVLQ 533 F+EGDFDTYV QMR PH+WGGEPELLMSSHVLQ Sbjct: 61 FVEGDFDTYVAQMRQPHVWGGEPELLMSSHVLQ 93 >ref|XP_006591462.1| PREDICTED: OTU domain-containing protein At3g57810-like isoform X3 [Glycine max] Length = 127 Score = 68.6 bits (166), Expect = 2e-09 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -2 Query: 631 FLEGDFDTYVTQMRHPHIWGGEPELLMSSHVLQ 533 FLEGDFDTY QMR PHIWGGEPELLMSSHVLQ Sbjct: 71 FLEGDFDTYTVQMRKPHIWGGEPELLMSSHVLQ 103 >ref|XP_006591461.1| PREDICTED: OTU domain-containing protein At3g57810-like isoform X2 [Glycine max] Length = 146 Score = 68.6 bits (166), Expect = 2e-09 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -2 Query: 631 FLEGDFDTYVTQMRHPHIWGGEPELLMSSHVLQ 533 FLEGDFDTY QMR PHIWGGEPELLMSSHVLQ Sbjct: 64 FLEGDFDTYTVQMRKPHIWGGEPELLMSSHVLQ 96 >ref|XP_006591460.1| PREDICTED: OTU domain-containing protein At3g57810-like isoform X1 [Glycine max] Length = 153 Score = 68.6 bits (166), Expect = 2e-09 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -2 Query: 631 FLEGDFDTYVTQMRHPHIWGGEPELLMSSHVLQ 533 FLEGDFDTY QMR PHIWGGEPELLMSSHVLQ Sbjct: 71 FLEGDFDTYTVQMRKPHIWGGEPELLMSSHVLQ 103 >ref|XP_006402837.1| hypothetical protein EUTSA_v10006116mg [Eutrema salsugineum] gi|567183962|ref|XP_006402838.1| hypothetical protein EUTSA_v10006116mg [Eutrema salsugineum] gi|557103936|gb|ESQ44290.1| hypothetical protein EUTSA_v10006116mg [Eutrema salsugineum] gi|557103937|gb|ESQ44291.1| hypothetical protein EUTSA_v10006116mg [Eutrema salsugineum] Length = 306 Score = 68.2 bits (165), Expect = 2e-09 Identities = 33/68 (48%), Positives = 44/68 (64%) Frame = -2 Query: 631 FLEGDFDTYVTQMRHPHIWGGEPELLMSSHVLQ*VFIL*RSSASTTYLLDLGVHVRHGKL 452 F+EGDFDTYVTQ+R PH+WGGEPEL M+SHVLQ + + V+++ K Sbjct: 218 FVEGDFDTYVTQIREPHVWGGEPELFMASHVLQ---------------MPITVYMKDEKA 262 Query: 451 VGILSIKE 428 G++SI E Sbjct: 263 GGLISIAE 270 >ref|XP_007163740.1| hypothetical protein PHAVU_001G260200g [Phaseolus vulgaris] gi|561037204|gb|ESW35734.1| hypothetical protein PHAVU_001G260200g [Phaseolus vulgaris] Length = 150 Score = 67.0 bits (162), Expect = 4e-09 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -2 Query: 631 FLEGDFDTYVTQMRHPHIWGGEPELLMSSHVLQ 533 FLEGDF+TY QMR PHIWGGEPELLMSSHVLQ Sbjct: 64 FLEGDFETYTVQMRKPHIWGGEPELLMSSHVLQ 96 >ref|XP_007163739.1| hypothetical protein PHAVU_001G260200g [Phaseolus vulgaris] gi|561037203|gb|ESW35733.1| hypothetical protein PHAVU_001G260200g [Phaseolus vulgaris] Length = 157 Score = 67.0 bits (162), Expect = 4e-09 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -2 Query: 631 FLEGDFDTYVTQMRHPHIWGGEPELLMSSHVLQ 533 FLEGDF+TY QMR PHIWGGEPELLMSSHVLQ Sbjct: 71 FLEGDFETYTVQMRKPHIWGGEPELLMSSHVLQ 103 >ref|XP_006659568.1| PREDICTED: OTU domain-containing protein At3g57810-like [Oryza brachyantha] Length = 308 Score = 66.6 bits (161), Expect = 6e-09 Identities = 26/33 (78%), Positives = 32/33 (96%) Frame = -2 Query: 631 FLEGDFDTYVTQMRHPHIWGGEPELLMSSHVLQ 533 F+EGDFDTYV+ +RHPH+WGGEPELLM+SHVL+ Sbjct: 222 FVEGDFDTYVSHIRHPHVWGGEPELLMASHVLE 254 >ref|XP_006850126.1| hypothetical protein AMTR_s00022p00229870 [Amborella trichopoda] gi|548853724|gb|ERN11707.1| hypothetical protein AMTR_s00022p00229870 [Amborella trichopoda] Length = 244 Score = 66.6 bits (161), Expect = 6e-09 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = -2 Query: 631 FLEGDFDTYVTQMRHPHIWGGEPELLMSSHVLQ 533 F+EGDFDTYV+Q+R PH+WGGEPELLM+SHVLQ Sbjct: 163 FIEGDFDTYVSQIRKPHVWGGEPELLMASHVLQ 195 >gb|EMT22953.1| hypothetical protein F775_07831 [Aegilops tauschii] Length = 267 Score = 66.6 bits (161), Expect = 6e-09 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = -2 Query: 631 FLEGDFDTYVTQMRHPHIWGGEPELLMSSHVLQ 533 F+EGDFDTYV+Q+R PH+WGGEPELLM+SHVLQ Sbjct: 179 FIEGDFDTYVSQIRKPHVWGGEPELLMASHVLQ 211 >gb|EMS56573.1| hypothetical protein TRIUR3_04599 [Triticum urartu] Length = 241 Score = 66.6 bits (161), Expect = 6e-09 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = -2 Query: 631 FLEGDFDTYVTQMRHPHIWGGEPELLMSSHVLQ 533 F+EGDFDTYV+Q+R PH+WGGEPELLM+SHVLQ Sbjct: 153 FIEGDFDTYVSQIRKPHVWGGEPELLMASHVLQ 185 >ref|XP_003632695.1| PREDICTED: OTU domain-containing protein At3g57810-like [Vitis vinifera] Length = 340 Score = 66.6 bits (161), Expect = 6e-09 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -2 Query: 631 FLEGDFDTYVTQMRHPHIWGGEPELLMSSHVLQ 533 F+EGDFDTYV+QMR PH+WGGEPEL M+SHVLQ Sbjct: 252 FIEGDFDTYVSQMRKPHVWGGEPELFMASHVLQ 284 >emb|CBI29898.3| unnamed protein product [Vitis vinifera] Length = 189 Score = 66.6 bits (161), Expect = 6e-09 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -2 Query: 631 FLEGDFDTYVTQMRHPHIWGGEPELLMSSHVLQ 533 F+EGDFDTYV+QMR PH+WGGEPEL M+SHVLQ Sbjct: 101 FIEGDFDTYVSQMRKPHVWGGEPELFMASHVLQ 133 >emb|CAN60311.1| hypothetical protein VITISV_002512 [Vitis vinifera] Length = 806 Score = 66.6 bits (161), Expect = 6e-09 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -2 Query: 631 FLEGDFDTYVTQMRHPHIWGGEPELLMSSHVLQ 533 F+EGDFDTYV+QMR PH+WGGEPEL M+SHVLQ Sbjct: 718 FIEGDFDTYVSQMRKPHVWGGEPELFMASHVLQ 750 >ref|XP_004291162.1| PREDICTED: OTU domain-containing protein At3g57810-like [Fragaria vesca subsp. vesca] Length = 343 Score = 66.2 bits (160), Expect = 8e-09 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = -2 Query: 631 FLEGDFDTYVTQMRHPHIWGGEPELLMSSHVLQ 533 F+EGDFDTYV+Q+R PH+WGGEPELLM+SHVLQ Sbjct: 255 FVEGDFDTYVSQIRKPHVWGGEPELLMASHVLQ 287 >tpg|DAA40387.1| TPA: hypothetical protein ZEAMMB73_782196, partial [Zea mays] Length = 155 Score = 66.2 bits (160), Expect = 8e-09 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = -2 Query: 631 FLEGDFDTYVTQMRHPHIWGGEPELLMSSHVLQ 533 F+EGDFDTYV+Q+R PH+WGGEPELLM+SHVLQ Sbjct: 67 FVEGDFDTYVSQIRKPHVWGGEPELLMASHVLQ 99 >ref|XP_002266448.1| PREDICTED: OTU domain-containing protein At3g57810 [Vitis vinifera] gi|297738381|emb|CBI27582.3| unnamed protein product [Vitis vinifera] Length = 155 Score = 66.2 bits (160), Expect = 8e-09 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -2 Query: 631 FLEGDFDTYVTQMRHPHIWGGEPELLMSSHVLQ 533 FLEGDFD YV +MR PHIWGGEPELLMSSHVLQ Sbjct: 64 FLEGDFDDYVLRMRQPHIWGGEPELLMSSHVLQ 96 >ref|XP_002514949.1| OTU domain-containing protein 6B, putative [Ricinus communis] gi|223546000|gb|EEF47503.1| OTU domain-containing protein 6B, putative [Ricinus communis] Length = 167 Score = 66.2 bits (160), Expect = 8e-09 Identities = 33/55 (60%), Positives = 40/55 (72%), Gaps = 3/55 (5%) Frame = -2 Query: 631 FLEGDFDTYVTQMRHPHIWGGEPELLMSSHVLQ---*VFIL*RSSASTTYLLDLG 476 FLE DFDTYV QMR PH+WGGEPELLMSSHVL+ V++ R+S S + + G Sbjct: 80 FLEDDFDTYVGQMRQPHVWGGEPELLMSSHVLKIPITVYMRDRNSGSLKVIAEYG 134 >ref|NP_001132051.1| hypothetical protein [Zea mays] gi|194693302|gb|ACF80735.1| unknown [Zea mays] gi|238007536|gb|ACR34803.1| unknown [Zea mays] gi|414589817|tpg|DAA40388.1| TPA: hypothetical protein ZEAMMB73_782196 [Zea mays] gi|414589818|tpg|DAA40389.1| TPA: hypothetical protein ZEAMMB73_782196 [Zea mays] Length = 310 Score = 66.2 bits (160), Expect = 8e-09 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = -2 Query: 631 FLEGDFDTYVTQMRHPHIWGGEPELLMSSHVLQ 533 F+EGDFDTYV+Q+R PH+WGGEPELLM+SHVLQ Sbjct: 222 FVEGDFDTYVSQIRKPHVWGGEPELLMASHVLQ 254 >ref|XP_006379934.1| hypothetical protein POPTR_0008s17740g [Populus trichocarpa] gi|550333321|gb|ERP57731.1| hypothetical protein POPTR_0008s17740g [Populus trichocarpa] Length = 155 Score = 65.9 bits (159), Expect = 1e-08 Identities = 32/55 (58%), Positives = 40/55 (72%), Gaps = 3/55 (5%) Frame = -2 Query: 631 FLEGDFDTYVTQMRHPHIWGGEPELLMSSHVLQ---*VFIL*RSSASTTYLLDLG 476 F+E DFDTYV +MR PH+WGGEPELLMSSHVL+ V++ RSS S + + G Sbjct: 64 FIEDDFDTYVVKMRQPHVWGGEPELLMSSHVLKMPITVYMRDRSSGSLKIIAEYG 118