BLASTX nr result
ID: Akebia25_contig00012606
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00012606 (201 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002274451.2| PREDICTED: uncharacterized protein LOC100258... 63 4e-08 emb|CBI25975.3| unnamed protein product [Vitis vinifera] 63 4e-08 gb|EXB75664.1| Putative vacuolar protein sorting-associated prot... 57 3e-06 ref|XP_007225547.1| hypothetical protein PRUPE_ppa000005m2g, par... 57 3e-06 >ref|XP_002274451.2| PREDICTED: uncharacterized protein LOC100258011 [Vitis vinifera] Length = 4275 Score = 63.2 bits (152), Expect = 4e-08 Identities = 36/65 (55%), Positives = 44/65 (67%) Frame = +2 Query: 2 LKIKDEL*GRLSMSP*YLAFSVLKDSAVVASPTTLDHNEQELHKIFMEEDVIYKDAFSDF 181 LKIKDEL GRLS S YLA SV ++ + ASP LD + +EL EED I+KDA DF Sbjct: 1069 LKIKDELQGRLSTSLQYLACSVHENDHLFASPRNLDPSVKELSTAQPEEDDIFKDALQDF 1128 Query: 182 LSVPD 196 +S+PD Sbjct: 1129 MSLPD 1133 >emb|CBI25975.3| unnamed protein product [Vitis vinifera] Length = 4328 Score = 63.2 bits (152), Expect = 4e-08 Identities = 36/65 (55%), Positives = 44/65 (67%) Frame = +2 Query: 2 LKIKDEL*GRLSMSP*YLAFSVLKDSAVVASPTTLDHNEQELHKIFMEEDVIYKDAFSDF 181 LKIKDEL GRLS S YLA SV ++ + ASP LD + +EL EED I+KDA DF Sbjct: 1102 LKIKDELQGRLSTSLQYLACSVHENDHLFASPRNLDPSVKELSTAQPEEDDIFKDALQDF 1161 Query: 182 LSVPD 196 +S+PD Sbjct: 1162 MSLPD 1166 >gb|EXB75664.1| Putative vacuolar protein sorting-associated protein 13A [Morus notabilis] Length = 4467 Score = 57.0 bits (136), Expect = 3e-06 Identities = 31/65 (47%), Positives = 41/65 (63%) Frame = +2 Query: 2 LKIKDEL*GRLSMSP*YLAFSVLKDSAVVASPTTLDHNEQELHKIFMEEDVIYKDAFSDF 181 LKI+DEL GRLS SP YLA SVL++ V +SP D + +E+ E+D + DA DF Sbjct: 1216 LKIRDELQGRLSASPQYLACSVLRNDCVFSSPNFTDPHGKEMPVTLHEDDDAFTDALPDF 1275 Query: 182 LSVPD 196 S+ D Sbjct: 1276 ASLSD 1280 >ref|XP_007225547.1| hypothetical protein PRUPE_ppa000005m2g, partial [Prunus persica] gi|462422483|gb|EMJ26746.1| hypothetical protein PRUPE_ppa000005m2g, partial [Prunus persica] Length = 2402 Score = 57.0 bits (136), Expect = 3e-06 Identities = 30/65 (46%), Positives = 42/65 (64%) Frame = +2 Query: 2 LKIKDEL*GRLSMSP*YLAFSVLKDSAVVASPTTLDHNEQELHKIFMEEDVIYKDAFSDF 181 LKIKDEL GRLS +P YLA SVL + V+SP +D + +E+ + +D + DA DF Sbjct: 1082 LKIKDELQGRLSTTPQYLACSVLNNDNSVSSPVIIDPHWKEMSTLLHADDDTFTDALPDF 1141 Query: 182 LSVPD 196 +S+ D Sbjct: 1142 MSMSD 1146