BLASTX nr result
ID: Akebia25_contig00012286
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00012286 (264 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI23450.3| unnamed protein product [Vitis vinifera] 102 7e-20 ref|XP_003635466.1| PREDICTED: cysteine-rich receptor-like prote... 101 1e-19 emb|CBI38478.3| unnamed protein product [Vitis vinifera] 101 1e-19 ref|XP_006589610.1| PREDICTED: cysteine-rich receptor-like prote... 100 2e-19 ref|XP_003635322.1| PREDICTED: cysteine-rich receptor-like prote... 100 3e-19 ref|XP_007143160.1| hypothetical protein PHAVU_007G048900g [Phas... 99 8e-19 ref|XP_007025550.1| Cysteine-rich RLK 8, putative [Theobroma cac... 98 1e-18 ref|XP_007214583.1| hypothetical protein PRUPE_ppa026781mg [Prun... 97 2e-18 ref|XP_007025937.1| Cysteine-rich RLK 29, putative [Theobroma ca... 97 2e-18 ref|XP_002267916.2| PREDICTED: cysteine-rich receptor-like prote... 97 2e-18 emb|CAN74851.1| hypothetical protein VITISV_019620 [Vitis vinifera] 97 2e-18 gb|EXB38211.1| Cysteine-rich receptor-like protein kinase 29 [Mo... 96 5e-18 ref|XP_003638011.1| Cysteine-rich receptor-like protein kinase, ... 96 5e-18 ref|XP_003637963.1| Cysteine-rich receptor-like protein kinase [... 96 5e-18 ref|XP_007025939.1| Cysteine-rich RLK 29 [Theobroma cacao] gi|50... 94 2e-17 ref|XP_006590220.1| PREDICTED: cysteine-rich receptor-like prote... 94 3e-17 gb|ACU20179.1| unknown [Glycine max] 93 4e-17 ref|XP_007143162.1| hypothetical protein PHAVU_007G049100g [Phas... 92 6e-17 emb|CBI41018.3| unnamed protein product [Vitis vinifera] 92 8e-17 ref|XP_003635308.1| PREDICTED: cysteine-rich receptor-like prote... 92 8e-17 >emb|CBI23450.3| unnamed protein product [Vitis vinifera] Length = 423 Score = 102 bits (253), Expect = 7e-20 Identities = 50/85 (58%), Positives = 58/85 (68%) Frame = +2 Query: 2 ITQRCPTQKEPIVWYDECMLRYSNRSIFFTMQDSPTVYMWNMNNLSNPNQFNSILNELMD 181 +TQ CP QKE I WYD+CMLRYSN SIF T Q S + YMWN N SN FN +L LM Sbjct: 153 LTQLCPNQKEAIGWYDKCMLRYSNNSIFGTAQTSLSFYMWNPENASNVEDFNQVLGNLMA 212 Query: 182 GLVRRAANGSSTLKFATQEADVTNF 256 L +AA+G S KFAT EA+VT+F Sbjct: 213 SLRSKAASGDSRHKFATGEANVTSF 237 >ref|XP_003635466.1| PREDICTED: cysteine-rich receptor-like protein kinase 25-like [Vitis vinifera] Length = 675 Score = 101 bits (252), Expect = 1e-19 Identities = 49/86 (56%), Positives = 59/86 (68%) Frame = +2 Query: 2 ITQRCPTQKEPIVWYDECMLRYSNRSIFFTMQDSPTVYMWNMNNLSNPNQFNSILNELMD 181 +T+ CP QKE I WYD CMLRYSN SIF Q SPT MWN+ N+SN FN +L LM Sbjct: 105 LTRLCPNQKEAIGWYDGCMLRYSNDSIFGKAQTSPTFTMWNLQNVSNVEDFNQVLGNLMA 164 Query: 182 GLVRRAANGSSTLKFATQEADVTNFQ 259 L +AA+G KFAT+EA+VT+FQ Sbjct: 165 SLRSKAASGDWRRKFATEEANVTSFQ 190 >emb|CBI38478.3| unnamed protein product [Vitis vinifera] Length = 519 Score = 101 bits (252), Expect = 1e-19 Identities = 49/86 (56%), Positives = 59/86 (68%) Frame = +2 Query: 2 ITQRCPTQKEPIVWYDECMLRYSNRSIFFTMQDSPTVYMWNMNNLSNPNQFNSILNELMD 181 +T+ CP QKE I WYD CMLRYSN SIF Q SPT MWN+ N+SN FN +L LM Sbjct: 105 LTRLCPNQKEAIGWYDGCMLRYSNDSIFGKAQTSPTFTMWNLQNVSNVEDFNQVLGNLMA 164 Query: 182 GLVRRAANGSSTLKFATQEADVTNFQ 259 L +AA+G KFAT+EA+VT+FQ Sbjct: 165 SLRSKAASGDWRRKFATEEANVTSFQ 190 >ref|XP_006589610.1| PREDICTED: cysteine-rich receptor-like protein kinase 26-like [Glycine max] Length = 666 Score = 100 bits (249), Expect = 2e-19 Identities = 46/86 (53%), Positives = 61/86 (70%) Frame = +2 Query: 2 ITQRCPTQKEPIVWYDECMLRYSNRSIFFTMQDSPTVYMWNMNNLSNPNQFNSILNELMD 181 +TQRCP QKE I WYD+CMLRYSNRSIF TM+ +PT ++W +N ++ +QFN L L+D Sbjct: 106 LTQRCPNQKEAIGWYDDCMLRYSNRSIFETMEPNPTYFLWTQSNATDMDQFNEALRGLVD 165 Query: 182 GLVRRAANGSSTLKFATQEADVTNFQ 259 GL +AA+G S K+A A +FQ Sbjct: 166 GLRSKAASGDSLKKYAAGSAAGPSFQ 191 >ref|XP_003635322.1| PREDICTED: cysteine-rich receptor-like protein kinase 25-like [Vitis vinifera] Length = 751 Score = 100 bits (248), Expect = 3e-19 Identities = 48/86 (55%), Positives = 59/86 (68%) Frame = +2 Query: 2 ITQRCPTQKEPIVWYDECMLRYSNRSIFFTMQDSPTVYMWNMNNLSNPNQFNSILNELMD 181 +T+ CP QKE I WYD CMLRYSN SIF Q SP+ MWN+ N+SN FN +L LM Sbjct: 175 LTRLCPNQKEAIGWYDGCMLRYSNDSIFGKAQTSPSFTMWNLQNVSNVEDFNQVLGNLMA 234 Query: 182 GLVRRAANGSSTLKFATQEADVTNFQ 259 L +AA+G KFAT+EA+VT+FQ Sbjct: 235 SLRSKAASGDWRRKFATEEANVTSFQ 260 >ref|XP_007143160.1| hypothetical protein PHAVU_007G048900g [Phaseolus vulgaris] gi|561016350|gb|ESW15154.1| hypothetical protein PHAVU_007G048900g [Phaseolus vulgaris] Length = 671 Score = 98.6 bits (244), Expect = 8e-19 Identities = 48/87 (55%), Positives = 60/87 (68%), Gaps = 1/87 (1%) Frame = +2 Query: 2 ITQRCPTQKEPIVWYDECMLRYSNRSIFFTMQDSPTVYMWNMNNLSNPNQFNSILNELMD 181 IT+RCP QK+ I+W D+CMLRYSN +IF M+ SPT YMWN N ++ NQFN +L LM Sbjct: 102 ITERCPNQKKAILWSDQCMLRYSNDTIFNQMEISPTYYMWNQPNATDANQFNEVLGNLMK 161 Query: 182 GLVRRAANGSSTLKFATQE-ADVTNFQ 259 L+ AA+G S K+AT E A NFQ Sbjct: 162 SLIDTAASGDSRRKYATAENATGLNFQ 188 >ref|XP_007025550.1| Cysteine-rich RLK 8, putative [Theobroma cacao] gi|508780916|gb|EOY28172.1| Cysteine-rich RLK 8, putative [Theobroma cacao] Length = 316 Score = 98.2 bits (243), Expect = 1e-18 Identities = 50/85 (58%), Positives = 59/85 (69%) Frame = +2 Query: 5 TQRCPTQKEPIVWYDECMLRYSNRSIFFTMQDSPTVYMWNMNNLSNPNQFNSILNELMDG 184 T+ CP Q+E IVWYDECMLRYSNRSIF MQ P M N+NN+SN NQFN +L L+ Sbjct: 104 TENCPNQREAIVWYDECMLRYSNRSIFGKMQFPPAWVMENVNNVSNVNQFNQVLAILLGD 163 Query: 185 LVRRAANGSSTLKFATQEADVTNFQ 259 L +AA+G S KFAT A V+N Q Sbjct: 164 LRIQAASGDSLHKFATGNATVSNSQ 188 >ref|XP_007214583.1| hypothetical protein PRUPE_ppa026781mg [Prunus persica] gi|462410448|gb|EMJ15782.1| hypothetical protein PRUPE_ppa026781mg [Prunus persica] Length = 659 Score = 97.4 bits (241), Expect = 2e-18 Identities = 43/88 (48%), Positives = 64/88 (72%), Gaps = 1/88 (1%) Frame = +2 Query: 2 ITQRCPTQKEPIVWYDECMLRYSNRSIFFTMQDSPTVYMWNMNNLSNPNQFNSILNELMD 181 + + CP +K I+WYD+CMLRYSN S F M ++P VY+WN+ N+++PN+FN +L E ++ Sbjct: 97 VKEYCPFRKVTIIWYDDCMLRYSNVSFFGNMDEAPRVYLWNVGNITDPNRFNKVLGETIN 156 Query: 182 GLVRRAANGSS-TLKFATQEADVTNFQK 262 GLV AAN +S T KFA ++ + T FQ+ Sbjct: 157 GLVPVAANAASGTKKFAAKKTNFTAFQE 184 >ref|XP_007025937.1| Cysteine-rich RLK 29, putative [Theobroma cacao] gi|508781303|gb|EOY28559.1| Cysteine-rich RLK 29, putative [Theobroma cacao] Length = 680 Score = 97.1 bits (240), Expect = 2e-18 Identities = 44/86 (51%), Positives = 59/86 (68%) Frame = +2 Query: 2 ITQRCPTQKEPIVWYDECMLRYSNRSIFFTMQDSPTVYMWNMNNLSNPNQFNSILNELMD 181 + RCP QKE I+WYD CMLRY+NRSIF M+ P+ YMWN+NN+++ + FN L+ LM+ Sbjct: 104 LRNRCPNQKEAIIWYDFCMLRYTNRSIFGIMETEPSFYMWNLNNVTDVDAFNQALSALMN 163 Query: 182 GLVRRAANGSSTLKFATQEADVTNFQ 259 L A++G+S FAT VT FQ Sbjct: 164 NLRTNASSGTSLGNFATGSRQVTAFQ 189 >ref|XP_002267916.2| PREDICTED: cysteine-rich receptor-like protein kinase 25-like isoform 1 [Vitis vinifera] Length = 663 Score = 97.1 bits (240), Expect = 2e-18 Identities = 42/87 (48%), Positives = 58/87 (66%) Frame = +2 Query: 2 ITQRCPTQKEPIVWYDECMLRYSNRSIFFTMQDSPTVYMWNMNNLSNPNQFNSILNELMD 181 + QRC K+ I+WYDECMLRYSN S F + +SP V MWN N++ P+QFN +L + +D Sbjct: 102 VRQRCRGFKQAIIWYDECMLRYSNESFFSQVSESPRVSMWNTQNITEPDQFNQVLGDTLD 161 Query: 182 GLVRRAANGSSTLKFATQEADVTNFQK 262 + +A N S KFAT+E + T FQ+ Sbjct: 162 SIRTQAVNDQSGKKFATKEENFTGFQR 188 >emb|CAN74851.1| hypothetical protein VITISV_019620 [Vitis vinifera] Length = 839 Score = 97.1 bits (240), Expect = 2e-18 Identities = 48/86 (55%), Positives = 57/86 (66%) Frame = +2 Query: 2 ITQRCPTQKEPIVWYDECMLRYSNRSIFFTMQDSPTVYMWNMNNLSNPNQFNSILNELMD 181 +TQ CP QKE I WYD CMLRYSN SIF T Q SP YM N N S+ +FN +L +M Sbjct: 269 LTQLCPNQKEAIGWYDNCMLRYSNDSIFGTQQSSPYFYMRNSKNASDVEEFNQVLGNMMA 328 Query: 182 GLVRRAANGSSTLKFATQEADVTNFQ 259 L +AA+G KFAT EA+VT+FQ Sbjct: 329 SLRSKAASGDWRRKFATGEANVTSFQ 354 >gb|EXB38211.1| Cysteine-rich receptor-like protein kinase 29 [Morus notabilis] Length = 679 Score = 95.9 bits (237), Expect = 5e-18 Identities = 48/87 (55%), Positives = 59/87 (67%), Gaps = 1/87 (1%) Frame = +2 Query: 2 ITQRCPTQKEPIVWYDECMLRYSNRSIFFTMQDSPTVYMWNMNNL-SNPNQFNSILNELM 178 + Q CP QKE + WYD CMLRYSNRS+F M+ S VY+WN N+ SN ++F S L L+ Sbjct: 109 LPQNCPNQKEAVGWYDYCMLRYSNRSMFGVMETSLKVYLWNTQNVSSNVDEFFSDLRTLL 168 Query: 179 DGLVRRAANGSSTLKFATQEADVTNFQ 259 DGL RAA+GSS KFAT A +FQ Sbjct: 169 DGLKNRAASGSSLRKFATGNASAPDFQ 195 >ref|XP_003638011.1| Cysteine-rich receptor-like protein kinase, partial [Medicago truncatula] gi|355503946|gb|AES85149.1| Cysteine-rich receptor-like protein kinase, partial [Medicago truncatula] Length = 552 Score = 95.9 bits (237), Expect = 5e-18 Identities = 49/88 (55%), Positives = 59/88 (67%), Gaps = 2/88 (2%) Frame = +2 Query: 2 ITQRCPTQKEPIVWYDECMLRYSNRSIFFTMQDSPTVYMWNMNNLSNPNQFNSILNELMD 181 +T+ CP QKE I WYD CMLRYSNRSIF M+ SP YMWN+ N++ +QFN +L LM Sbjct: 108 LTKLCPNQKEAIGWYDNCMLRYSNRSIFGVMEGSPKFYMWNIYNVTEVDQFNQVLGNLMR 167 Query: 182 GLVRRAANGSSTLKFATQEA-DVT-NFQ 259 L +AA+ S KFAT A DV NFQ Sbjct: 168 KLKEKAASSDSRRKFATDNATDVNLNFQ 195 >ref|XP_003637963.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula] gi|355503898|gb|AES85101.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula] Length = 671 Score = 95.9 bits (237), Expect = 5e-18 Identities = 49/88 (55%), Positives = 59/88 (67%), Gaps = 2/88 (2%) Frame = +2 Query: 2 ITQRCPTQKEPIVWYDECMLRYSNRSIFFTMQDSPTVYMWNMNNLSNPNQFNSILNELMD 181 +T+ CP QKE I WYD CMLRYSNRSIF M+ SP YMWN+ N++ +QFN +L LM Sbjct: 108 LTKLCPNQKEAIGWYDNCMLRYSNRSIFGVMEGSPKFYMWNIYNVTEVDQFNQVLGNLMR 167 Query: 182 GLVRRAANGSSTLKFATQEA-DVT-NFQ 259 L +AA+ S KFAT A DV NFQ Sbjct: 168 KLKEKAASSDSRRKFATDNATDVNLNFQ 195 >ref|XP_007025939.1| Cysteine-rich RLK 29 [Theobroma cacao] gi|508781305|gb|EOY28561.1| Cysteine-rich RLK 29 [Theobroma cacao] Length = 1349 Score = 94.0 bits (232), Expect = 2e-17 Identities = 43/82 (52%), Positives = 57/82 (69%) Frame = +2 Query: 14 CPTQKEPIVWYDECMLRYSNRSIFFTMQDSPTVYMWNMNNLSNPNQFNSILNELMDGLVR 193 CP QKE I+WYD CMLRY+NRSIF + +P+ YMWN NN+++ + FN L+ LM+ L Sbjct: 108 CPNQKEAIIWYDFCMLRYTNRSIFGVAETNPSFYMWNPNNVTDVDAFNQSLSALMNNLRT 167 Query: 194 RAANGSSTLKFATQEADVTNFQ 259 A++G+S KFAT VT FQ Sbjct: 168 NASSGTSLRKFATGSRQVTAFQ 189 Score = 68.9 bits (167), Expect = 7e-10 Identities = 34/86 (39%), Positives = 50/86 (58%) Frame = +2 Query: 2 ITQRCPTQKEPIVWYDECMLRYSNRSIFFTMQDSPTVYMWNMNNLSNPNQFNSILNELMD 181 + QRCP KE + W + C LRY+NR+I M+ SP + N N++N NQFN L++L++ Sbjct: 789 LRQRCPLSKEVVGWSEFCTLRYANRNILGEMEISPGSCLLNTQNVTNANQFNQALSDLLN 848 Query: 182 GLVRRAANGSSTLKFATQEADVTNFQ 259 L AA K+A ++V FQ Sbjct: 849 NLSSLAAAAGPLRKYAAGNSEVRLFQ 874 >ref|XP_006590220.1| PREDICTED: cysteine-rich receptor-like protein kinase 29-like [Glycine max] Length = 673 Score = 93.6 bits (231), Expect = 3e-17 Identities = 42/87 (48%), Positives = 58/87 (66%) Frame = +2 Query: 2 ITQRCPTQKEPIVWYDECMLRYSNRSIFFTMQDSPTVYMWNMNNLSNPNQFNSILNELMD 181 +TQRCP QKE I++YD CMLRYSN +IF M+ SP +++ N N ++ QFN +L LM Sbjct: 105 LTQRCPNQKEAIIYYDNCMLRYSNTTIFGVMETSPALFLGNTVNATDVEQFNQVLQTLMS 164 Query: 182 GLVRRAANGSSTLKFATQEADVTNFQK 262 L RAA+G S K+AT + +FQ+ Sbjct: 165 NLTDRAASGDSRRKYATDDTTAASFQR 191 >gb|ACU20179.1| unknown [Glycine max] Length = 225 Score = 92.8 bits (229), Expect = 4e-17 Identities = 44/86 (51%), Positives = 57/86 (66%) Frame = +2 Query: 2 ITQRCPTQKEPIVWYDECMLRYSNRSIFFTMQDSPTVYMWNMNNLSNPNQFNSILNELMD 181 +TQRCP QKE I++YDEC+LRYS+RSIF M+ SP ++N+ N +N QFN +L LM Sbjct: 105 LTQRCPNQKEAIIYYDECLLRYSDRSIFGVMETSPDYVLFNIQNATNVGQFNQVLRNLMR 164 Query: 182 GLVRRAANGSSTLKFATQEADVTNFQ 259 L AA+G S K+A A TN Q Sbjct: 165 MLTGIAASGDSRRKYAAASATATNIQ 190 >ref|XP_007143162.1| hypothetical protein PHAVU_007G049100g [Phaseolus vulgaris] gi|561016352|gb|ESW15156.1| hypothetical protein PHAVU_007G049100g [Phaseolus vulgaris] Length = 673 Score = 92.4 bits (228), Expect = 6e-17 Identities = 45/87 (51%), Positives = 57/87 (65%), Gaps = 1/87 (1%) Frame = +2 Query: 2 ITQRCPTQKEPIVWYDECMLRYSNRSIFFTMQDSPTVYMWNMNNLSNPNQFNSILNELMD 181 +T+RCP QK+ I+W D+CMLRYSN +IF M+ SP YMWN N ++ QFN +L LM Sbjct: 102 LTERCPNQKKAIMWSDQCMLRYSNYTIFHQMETSPRYYMWNTANATDATQFNEVLGNLMK 161 Query: 182 GLVRRAANGSSTLKFATQE-ADVTNFQ 259 L AA+G S K+AT E A NFQ Sbjct: 162 SLKDTAASGDSRRKYATAENATGLNFQ 188 >emb|CBI41018.3| unnamed protein product [Vitis vinifera] Length = 690 Score = 92.0 bits (227), Expect = 8e-17 Identities = 47/83 (56%), Positives = 58/83 (69%) Frame = +2 Query: 2 ITQRCPTQKEPIVWYDECMLRYSNRSIFFTMQDSPTVYMWNMNNLSNPNQFNSILNELMD 181 + QRCP Q E I YDECMLRYSNRSIF T++ P+ Y+ N NN+SN + FN L L+D Sbjct: 109 LPQRCPYQNEAIGGYDECMLRYSNRSIFRTLEILPSFYVSNPNNVSNEDVFNQALKTLLD 168 Query: 182 GLVRRAANGSSTLKFATQEADVT 250 L +AA+G+S LKFAT EA T Sbjct: 169 SLRSKAASGNSLLKFATGEATGT 191 >ref|XP_003635308.1| PREDICTED: cysteine-rich receptor-like protein kinase 29-like [Vitis vinifera] Length = 678 Score = 92.0 bits (227), Expect = 8e-17 Identities = 47/83 (56%), Positives = 58/83 (69%) Frame = +2 Query: 2 ITQRCPTQKEPIVWYDECMLRYSNRSIFFTMQDSPTVYMWNMNNLSNPNQFNSILNELMD 181 + QRCP Q E I YDECMLRYSNRSIF T++ P+ Y+ N NN+SN + FN L L+D Sbjct: 109 LPQRCPYQNEAIGGYDECMLRYSNRSIFRTLEILPSFYVSNPNNVSNEDVFNQALKTLLD 168 Query: 182 GLVRRAANGSSTLKFATQEADVT 250 L +AA+G+S LKFAT EA T Sbjct: 169 SLRSKAASGNSLLKFATGEATGT 191