BLASTX nr result
ID: Akebia25_contig00012281
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00012281 (203 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU26514.1| hypothetical protein MIMGU_mgv1a015835mg [Mimulus... 58 1e-06 gb|AEI83424.1| chloroplast ferredoxin I [Camellia sinensis] 58 1e-06 ref|XP_002269617.1| PREDICTED: ferredoxin-1, chloroplastic-like ... 58 1e-06 sp|P83522.1|FER_HORVU RecName: Full=Ferredoxin 58 2e-06 prf||1802399A ferredoxin 58 2e-06 sp|P00221.2|FER1_SPIOL RecName: Full=Ferredoxin-1, chloroplastic... 57 2e-06 gb|AAB25190.1| ferredoxin A isoprotein, Fd A [Alocasia macrorrhi... 57 3e-06 sp|P81372.1|FERA_ALOMA RecName: Full=Ferredoxin-A; Short=Fd A 57 3e-06 sp|P81373.1|FERB_ALOMA RecName: Full=Ferredoxin-B; Short=Fd B gi... 57 3e-06 ref|XP_003592975.1| Ferredoxin I [Medicago truncatula] gi|355482... 57 3e-06 sp|P00226.1|FER_SAMNI RecName: Full=Ferredoxin gi|223163|prf||06... 56 5e-06 sp|P00224.1|FER2_SPIOL RecName: Full=Ferredoxin-2; AltName: Full... 56 5e-06 pdb|1A70|A Chain A, Spinach Ferredoxin 56 6e-06 sp|P00223.1|FER_ARCLA RecName: Full=Ferredoxin gi|223585|prf||09... 56 6e-06 >gb|EYU26514.1| hypothetical protein MIMGU_mgv1a015835mg [Mimulus guttatus] Length = 144 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 201 QMDEGWVLTCVAYPLSDVVIETNKEEELTA 112 QM+EGWVLTCVAYP DVVIET+KEEELTA Sbjct: 115 QMEEGWVLTCVAYPTGDVVIETHKEEELTA 144 >gb|AEI83424.1| chloroplast ferredoxin I [Camellia sinensis] Length = 147 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 201 QMDEGWVLTCVAYPLSDVVIETNKEEELTA 112 QMD GWVLTCVAYP SDVVIET+KEEELTA Sbjct: 118 QMDGGWVLTCVAYPQSDVVIETHKEEELTA 147 >ref|XP_002269617.1| PREDICTED: ferredoxin-1, chloroplastic-like [Vitis vinifera] Length = 142 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -3 Query: 201 QMDEGWVLTCVAYPLSDVVIETNKEEELTA 112 QM+EGWVLTCVAYP SD+VIET+KEEELTA Sbjct: 113 QMEEGWVLTCVAYPQSDLVIETHKEEELTA 142 >sp|P83522.1|FER_HORVU RecName: Full=Ferredoxin Length = 97 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 201 QMDEGWVLTCVAYPLSDVVIETNKEEELTA 112 QM+EGWVLTC AYP SDVVIET+KEEELTA Sbjct: 68 QMEEGWVLTCAAYPKSDVVIETHKEEELTA 97 >prf||1802399A ferredoxin Length = 97 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 201 QMDEGWVLTCVAYPLSDVVIETNKEEELTA 112 QM+EGWVLTC AYP SDVVIET+KEEELTA Sbjct: 68 QMEEGWVLTCAAYPKSDVVIETHKEEELTA 97 >sp|P00221.2|FER1_SPIOL RecName: Full=Ferredoxin-1, chloroplastic; AltName: Full=Ferredoxin I; Short=Fd I; Flags: Precursor gi|170109|gb|AAA34028.1| ferredoxin I precursor [Spinacia oleracea] gi|227453|prf||1704156A ferredoxin I Length = 147 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -3 Query: 201 QMDEGWVLTCVAYPLSDVVIETNKEEELTA 112 Q+DEGWVLTC AYP+SDV IET+KEEELTA Sbjct: 118 QIDEGWVLTCAAYPVSDVTIETHKEEELTA 147 >gb|AAB25190.1| ferredoxin A isoprotein, Fd A [Alocasia macrorrhiza=elephant ear, Schott, Peptide, 97 aa] Length = 97 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -3 Query: 201 QMDEGWVLTCVAYPLSDVVIETNKEEELTA 112 QM++GWVLTCVA+P SDVVIET+KEEELTA Sbjct: 68 QMEQGWVLTCVAFPTSDVVIETHKEEELTA 97 >sp|P81372.1|FERA_ALOMA RecName: Full=Ferredoxin-A; Short=Fd A Length = 97 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -3 Query: 201 QMDEGWVLTCVAYPLSDVVIETNKEEELTA 112 QM++GWVLTCVA+P SDVVIET+KEEELTA Sbjct: 68 QMEQGWVLTCVAFPTSDVVIETHKEEELTA 97 >sp|P81373.1|FERB_ALOMA RecName: Full=Ferredoxin-B; Short=Fd B gi|264602|gb|AAB25191.1| ferredoxin B isoprotein, Fd B [Alocasia macrorrhiza=elephant ear, Schott, Peptide, 98 aa] Length = 98 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 201 QMDEGWVLTCVAYPLSDVVIETNKEEELTA 112 Q+ EGWVLTCVAYP SDVVIET+KEEELTA Sbjct: 69 QIGEGWVLTCVAYPTSDVVIETHKEEELTA 98 >ref|XP_003592975.1| Ferredoxin I [Medicago truncatula] gi|355482023|gb|AES63226.1| Ferredoxin I [Medicago truncatula] gi|388510582|gb|AFK43357.1| unknown [Medicago truncatula] Length = 150 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -3 Query: 201 QMDEGWVLTCVAYPLSDVVIETNKEEELTA 112 Q++EGWVLTCVAYP SDV IET+KEEELTA Sbjct: 121 QIEEGWVLTCVAYPTSDVTIETHKEEELTA 150 >sp|P00226.1|FER_SAMNI RecName: Full=Ferredoxin gi|223163|prf||0601253A ferredoxin Length = 97 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -3 Query: 201 QMDEGWVLTCVAYPLSDVVIETNKEEELTA 112 Q++EGWVLTCVAYP SDV IET+KEEELTA Sbjct: 68 QIEEGWVLTCVAYPKSDVTIETHKEEELTA 97 >sp|P00224.1|FER2_SPIOL RecName: Full=Ferredoxin-2; AltName: Full=Ferredoxin II Length = 97 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -3 Query: 201 QMDEGWVLTCVAYPLSDVVIETNKEEELTA 112 QM+EGWVLTC+AYP DV IET+KEEELTA Sbjct: 68 QMEEGWVLTCIAYPTGDVTIETHKEEELTA 97 >pdb|1A70|A Chain A, Spinach Ferredoxin Length = 97 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -3 Query: 201 QMDEGWVLTCVAYPLSDVVIETNKEEELTA 112 Q+DEGWVLTC AYP+SDV IET+K+EELTA Sbjct: 68 QIDEGWVLTCAAYPVSDVTIETHKKEELTA 97 >sp|P00223.1|FER_ARCLA RecName: Full=Ferredoxin gi|223585|prf||0901304A ferredoxin Length = 97 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -3 Query: 201 QMDEGWVLTCVAYPLSDVVIETNKEEELTA 112 QM+ GWVLTCVAYP SDV IET+KEEELTA Sbjct: 68 QMEAGWVLTCVAYPTSDVTIETHKEEELTA 97