BLASTX nr result
ID: Akebia25_contig00012163
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00012163 (954 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004307607.1| PREDICTED: pollen-specific protein SF3-like ... 65 5e-08 gb|AAD56951.1|AF184886_1 LIM domain protein WLIM2 [Nicotiana tab... 65 5e-08 gb|AFK39062.1| unknown [Lotus japonicus] gi|388521363|gb|AFK4874... 65 5e-08 ref|XP_002312139.1| LIM domain-containing family protein [Populu... 65 5e-08 gb|ABK94608.1| unknown [Populus trichocarpa] 65 5e-08 gb|ABK58469.1| LIM domain protein WLIM2a [Populus tremula x Popu... 65 5e-08 gb|AGJ83942.1| lim protein 2 [Gossypium hirsutum] 64 1e-07 gb|EMT19855.1| Pollen-specific protein SF3 [Aegilops tauschii] 64 1e-07 ref|XP_004239928.1| PREDICTED: pollen-specific protein SF3-like ... 64 1e-07 gb|AFK34184.1| unknown [Medicago truncatula] 64 1e-07 ref|XP_003558280.1| PREDICTED: pollen-specific protein SF3-like ... 64 1e-07 ref|XP_003600848.1| LIM domain-containing protein [Medicago trun... 64 1e-07 ref|XP_003600847.1| LIM domain-containing protein [Medicago trun... 64 1e-07 ref|XP_007163504.1| hypothetical protein PHAVU_001G239700g [Phas... 62 3e-07 ref|XP_007009110.1| GATA type zinc finger transcription factor f... 62 3e-07 ref|XP_007009108.1| GATA type zinc finger transcription factor f... 62 3e-07 ref|XP_007009107.1| GATA type zinc finger transcription factor f... 62 3e-07 ref|XP_007009106.1| GATA type zinc finger transcription factor f... 62 3e-07 ref|XP_007218461.1| hypothetical protein PRUPE_ppa011869mg [Prun... 62 3e-07 ref|XP_004167859.1| PREDICTED: LOW QUALITY PROTEIN: pollen-speci... 62 3e-07 >ref|XP_004307607.1| PREDICTED: pollen-specific protein SF3-like [Fragaria vesca subsp. vesca] Length = 200 Score = 64.7 bits (156), Expect = 5e-08 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +2 Query: 2 TRSASKAAGMFSGTQEKCATCGKTAYPLEKV 94 TRS SKAAGMFSGTQEKCATCGKTAYPLEKV Sbjct: 91 TRSPSKAAGMFSGTQEKCATCGKTAYPLEKV 121 >gb|AAD56951.1|AF184886_1 LIM domain protein WLIM2 [Nicotiana tabacum] gi|1841464|emb|CAA71891.1| LIM-domain SF3 protein [Nicotiana tabacum] Length = 189 Score = 64.7 bits (156), Expect = 5e-08 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +2 Query: 2 TRSASKAAGMFSGTQEKCATCGKTAYPLEKV 94 TRS SKAAGMFSGTQEKCATCGKTAYPLEKV Sbjct: 91 TRSPSKAAGMFSGTQEKCATCGKTAYPLEKV 121 >gb|AFK39062.1| unknown [Lotus japonicus] gi|388521363|gb|AFK48743.1| unknown [Lotus japonicus] Length = 189 Score = 64.7 bits (156), Expect = 5e-08 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +2 Query: 2 TRSASKAAGMFSGTQEKCATCGKTAYPLEKV 94 TRS SKAAGMFSGTQEKCATCGKTAYPLEKV Sbjct: 91 TRSPSKAAGMFSGTQEKCATCGKTAYPLEKV 121 >ref|XP_002312139.1| LIM domain-containing family protein [Populus trichocarpa] gi|118485190|gb|ABK94456.1| unknown [Populus trichocarpa] gi|222851959|gb|EEE89506.1| LIM domain-containing family protein [Populus trichocarpa] Length = 189 Score = 64.7 bits (156), Expect = 5e-08 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +2 Query: 2 TRSASKAAGMFSGTQEKCATCGKTAYPLEKV 94 TRS SKAAGMFSGTQEKCATCGKTAYPLEKV Sbjct: 91 TRSPSKAAGMFSGTQEKCATCGKTAYPLEKV 121 >gb|ABK94608.1| unknown [Populus trichocarpa] Length = 189 Score = 64.7 bits (156), Expect = 5e-08 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +2 Query: 2 TRSASKAAGMFSGTQEKCATCGKTAYPLEKV 94 TRS SKAAGMFSGTQEKCATCGKTAYPLEKV Sbjct: 91 TRSPSKAAGMFSGTQEKCATCGKTAYPLEKV 121 >gb|ABK58469.1| LIM domain protein WLIM2a [Populus tremula x Populus alba] Length = 189 Score = 64.7 bits (156), Expect = 5e-08 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +2 Query: 2 TRSASKAAGMFSGTQEKCATCGKTAYPLEKV 94 TRS SKAAGMFSGTQEKCATCGKTAYPLEKV Sbjct: 91 TRSPSKAAGMFSGTQEKCATCGKTAYPLEKV 121 >gb|AGJ83942.1| lim protein 2 [Gossypium hirsutum] Length = 189 Score = 63.5 bits (153), Expect = 1e-07 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +2 Query: 2 TRSASKAAGMFSGTQEKCATCGKTAYPLEKV 94 TRS SKAAGMFSGTQ+KCATCGKTAYPLEKV Sbjct: 90 TRSPSKAAGMFSGTQDKCATCGKTAYPLEKV 120 >gb|EMT19855.1| Pollen-specific protein SF3 [Aegilops tauschii] Length = 223 Score = 63.5 bits (153), Expect = 1e-07 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +2 Query: 2 TRSASKAAGMFSGTQEKCATCGKTAYPLEKV 94 TRS SKAAGMFSGTQ+KCATCGKTAYPLEKV Sbjct: 112 TRSPSKAAGMFSGTQDKCATCGKTAYPLEKV 142 >ref|XP_004239928.1| PREDICTED: pollen-specific protein SF3-like [Solanum lycopersicum] gi|565378453|ref|XP_006355670.1| PREDICTED: pollen-specific protein SF3-like [Solanum tuberosum] Length = 189 Score = 63.5 bits (153), Expect = 1e-07 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +2 Query: 2 TRSASKAAGMFSGTQEKCATCGKTAYPLEKV 94 T+S SKAAGMFSGTQEKCATCGKTAYPLEKV Sbjct: 91 TKSPSKAAGMFSGTQEKCATCGKTAYPLEKV 121 >gb|AFK34184.1| unknown [Medicago truncatula] Length = 191 Score = 63.5 bits (153), Expect = 1e-07 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +2 Query: 2 TRSASKAAGMFSGTQEKCATCGKTAYPLEKV 94 TR+ SKAAGMFSGTQEKCATCGKTAYPLEKV Sbjct: 93 TRTPSKAAGMFSGTQEKCATCGKTAYPLEKV 123 >ref|XP_003558280.1| PREDICTED: pollen-specific protein SF3-like [Brachypodium distachyon] Length = 195 Score = 63.5 bits (153), Expect = 1e-07 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +2 Query: 2 TRSASKAAGMFSGTQEKCATCGKTAYPLEKV 94 TRS SKAAGMFSGTQ+KCATCGKTAYPLEKV Sbjct: 91 TRSPSKAAGMFSGTQDKCATCGKTAYPLEKV 121 >ref|XP_003600848.1| LIM domain-containing protein [Medicago truncatula] gi|355489896|gb|AES71099.1| LIM domain-containing protein [Medicago truncatula] Length = 149 Score = 63.5 bits (153), Expect = 1e-07 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +2 Query: 2 TRSASKAAGMFSGTQEKCATCGKTAYPLEKV 94 TR+ SKAAGMFSGTQEKCATCGKTAYPLEKV Sbjct: 51 TRTPSKAAGMFSGTQEKCATCGKTAYPLEKV 81 >ref|XP_003600847.1| LIM domain-containing protein [Medicago truncatula] gi|217075140|gb|ACJ85930.1| unknown [Medicago truncatula] gi|217075428|gb|ACJ86074.1| unknown [Medicago truncatula] gi|355489895|gb|AES71098.1| LIM domain-containing protein [Medicago truncatula] gi|388501922|gb|AFK39027.1| unknown [Medicago truncatula] gi|388502664|gb|AFK39398.1| unknown [Medicago truncatula] Length = 191 Score = 63.5 bits (153), Expect = 1e-07 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +2 Query: 2 TRSASKAAGMFSGTQEKCATCGKTAYPLEKV 94 TR+ SKAAGMFSGTQEKCATCGKTAYPLEKV Sbjct: 93 TRTPSKAAGMFSGTQEKCATCGKTAYPLEKV 123 >ref|XP_007163504.1| hypothetical protein PHAVU_001G239700g [Phaseolus vulgaris] gi|593800936|ref|XP_007163505.1| hypothetical protein PHAVU_001G239700g [Phaseolus vulgaris] gi|543176792|gb|AGV54419.1| pollen-specific protein SF3-like isoform 1 [Phaseolus vulgaris] gi|561036968|gb|ESW35498.1| hypothetical protein PHAVU_001G239700g [Phaseolus vulgaris] gi|561036969|gb|ESW35499.1| hypothetical protein PHAVU_001G239700g [Phaseolus vulgaris] Length = 194 Score = 62.4 bits (150), Expect = 3e-07 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = +2 Query: 2 TRSASKAAGMFSGTQEKCATCGKTAYPLEKV 94 TRS SKAA MFSGTQEKCATCGKTAYPLEKV Sbjct: 91 TRSPSKAASMFSGTQEKCATCGKTAYPLEKV 121 >ref|XP_007009110.1| GATA type zinc finger transcription factor family protein isoform 5, partial [Theobroma cacao] gi|508726023|gb|EOY17920.1| GATA type zinc finger transcription factor family protein isoform 5, partial [Theobroma cacao] Length = 182 Score = 62.4 bits (150), Expect = 3e-07 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = +2 Query: 2 TRSASKAAGMFSGTQEKCATCGKTAYPLEKV 94 TRS SKAA MFSGTQEKCATCGKTAYPLEKV Sbjct: 84 TRSPSKAASMFSGTQEKCATCGKTAYPLEKV 114 >ref|XP_007009108.1| GATA type zinc finger transcription factor family protein isoform 3 [Theobroma cacao] gi|508726021|gb|EOY17918.1| GATA type zinc finger transcription factor family protein isoform 3 [Theobroma cacao] Length = 197 Score = 62.4 bits (150), Expect = 3e-07 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = +2 Query: 2 TRSASKAAGMFSGTQEKCATCGKTAYPLEKV 94 TRS SKAA MFSGTQEKCATCGKTAYPLEKV Sbjct: 99 TRSPSKAASMFSGTQEKCATCGKTAYPLEKV 129 >ref|XP_007009107.1| GATA type zinc finger transcription factor family protein isoform 2, partial [Theobroma cacao] gi|508726020|gb|EOY17917.1| GATA type zinc finger transcription factor family protein isoform 2, partial [Theobroma cacao] Length = 191 Score = 62.4 bits (150), Expect = 3e-07 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = +2 Query: 2 TRSASKAAGMFSGTQEKCATCGKTAYPLEKV 94 TRS SKAA MFSGTQEKCATCGKTAYPLEKV Sbjct: 93 TRSPSKAASMFSGTQEKCATCGKTAYPLEKV 123 >ref|XP_007009106.1| GATA type zinc finger transcription factor family protein isoform 1 [Theobroma cacao] gi|590562519|ref|XP_007009109.1| GATA type zinc finger transcription factor family protein isoform 1 [Theobroma cacao] gi|508726019|gb|EOY17916.1| GATA type zinc finger transcription factor family protein isoform 1 [Theobroma cacao] gi|508726022|gb|EOY17919.1| GATA type zinc finger transcription factor family protein isoform 1 [Theobroma cacao] Length = 189 Score = 62.4 bits (150), Expect = 3e-07 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = +2 Query: 2 TRSASKAAGMFSGTQEKCATCGKTAYPLEKV 94 TRS SKAA MFSGTQEKCATCGKTAYPLEKV Sbjct: 91 TRSPSKAASMFSGTQEKCATCGKTAYPLEKV 121 >ref|XP_007218461.1| hypothetical protein PRUPE_ppa011869mg [Prunus persica] gi|596007248|ref|XP_007218462.1| hypothetical protein PRUPE_ppa011869mg [Prunus persica] gi|462414923|gb|EMJ19660.1| hypothetical protein PRUPE_ppa011869mg [Prunus persica] gi|462414924|gb|EMJ19661.1| hypothetical protein PRUPE_ppa011869mg [Prunus persica] Length = 192 Score = 62.4 bits (150), Expect = 3e-07 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = +2 Query: 2 TRSASKAAGMFSGTQEKCATCGKTAYPLEKV 94 TRS SKAA MFSGTQEKCATCGKTAYPLEKV Sbjct: 91 TRSPSKAASMFSGTQEKCATCGKTAYPLEKV 121 >ref|XP_004167859.1| PREDICTED: LOW QUALITY PROTEIN: pollen-specific protein SF3-like [Cucumis sativus] Length = 195 Score = 62.4 bits (150), Expect = 3e-07 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = +2 Query: 2 TRSASKAAGMFSGTQEKCATCGKTAYPLEKV 94 TRS SKAA MFSGTQEKCATCGKTAYPLEKV Sbjct: 91 TRSPSKAASMFSGTQEKCATCGKTAYPLEKV 121