BLASTX nr result
ID: Akebia25_contig00012111
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00012111 (333 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAT46100.1| MADS-box protein [Akebia trifoliata] 79 5e-20 >gb|AAT46100.1| MADS-box protein [Akebia trifoliata] Length = 194 Score = 78.6 bits (192), Expect(2) = 5e-20 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = +3 Query: 51 NKMLCEKCGVLPGQELKQQLLEIAPFSQNSQNSDVET 161 NKMLCEKCGVLPGQELKQQLLEIAPFSQNSQNSDVET Sbjct: 127 NKMLCEKCGVLPGQELKQQLLEIAPFSQNSQNSDVET 163 Score = 44.7 bits (104), Expect(2) = 5e-20 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +2 Query: 200 EVETELYIGQPTRYPSHQG 256 EVETELYIGQPTRYPSHQG Sbjct: 176 EVETELYIGQPTRYPSHQG 194