BLASTX nr result
ID: Akebia25_contig00012073
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00012073 (1332 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_007516862.1| hypothetical protein GlmaxMp13 (mitochondrio... 71 9e-10 >ref|YP_007516862.1| hypothetical protein GlmaxMp13 (mitochondrion) [Glycine max] gi|403311591|gb|AFR34339.1| hypothetical protein GlmaxMp13 (mitochondrion) [Glycine max] Length = 287 Score = 71.2 bits (173), Expect = 9e-10 Identities = 40/63 (63%), Positives = 42/63 (66%), Gaps = 2/63 (3%) Frame = +2 Query: 458 VPKCFLWISNKGKFRPCYVI*LIQVLCCSPLPE--DRFELSFQDLQYDKFPLCYLAKLVL 631 VP C LWISNKGK Y+ LI+V CCSPLPE D E SFQDLQ D FPLCY AK Sbjct: 140 VPGCCLWISNKGKPPLFYLCHLIKVPCCSPLPEAKDGVEPSFQDLQSDTFPLCYPAKPAT 199 Query: 632 SRA 640 S A Sbjct: 200 SCA 202