BLASTX nr result
ID: Akebia25_contig00010791
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00010791 (404 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002842242.1| 40S ribosomal protein S29 [Tuber melanosporu... 112 7e-23 gb|EJT97456.1| ribosomal protein S14 [Dacryopinax sp. DJM-731 SS1] 110 2e-22 emb|CCX29580.1| Similar to 40S ribosomal protein S29; acc. no. Q... 110 3e-22 ref|XP_961514.1| 40S ribosomal protein S29 [Neurospora crassa OR... 109 3e-22 gb|ETI21492.1| 40S ribosomal protein S29 [Cladophialophora carri... 109 4e-22 gb|ERT02119.1| 40S ribosomal protein S29 [Sporothrix schenckii A... 109 4e-22 gb|EMC97799.1| hypothetical protein BAUCODRAFT_155088 [Baudoinia... 109 4e-22 gb|EWC48588.1| 40S ribosomal protein S29 [Drechslerella stenobro... 108 8e-22 emb|CCC10009.1| predicted 40S ribosomal protein S29 [Sordaria ma... 108 8e-22 ref|XP_003299484.1| 40S ribosomal protein S29 [Pyrenophora teres... 108 8e-22 gb|EOA87352.1| hypothetical protein SETTUDRAFT_163319 [Setosphae... 108 1e-21 ref|XP_003840039.1| hypothetical protein LEMA_P108250.1 [Leptosp... 108 1e-21 ref|XP_001595493.1| 40S ribosomal protein S29 [Sclerotinia scler... 108 1e-21 ref|XP_001552520.1| 40S ribosomal protein S29 [Botryotinia fucke... 108 1e-21 gb|ETN42172.1| 40S ribosomal protein S29 [Cyphellophora europaea... 107 1e-21 ref|XP_001912016.1| hypothetical protein [Podospora anserina S m... 107 1e-21 gb|EPQ65083.1| Protein component of the small (40S) ribosomal su... 107 2e-21 gb|EME48012.1| hypothetical protein DOTSEDRAFT_21726 [Dothistrom... 107 2e-21 gb|EMD87813.1| hypothetical protein COCHEDRAFT_1216936 [Bipolari... 107 2e-21 ref|XP_003855365.1| 40S ribosomal protein S29 [Zymoseptoria trit... 107 2e-21 >ref|XP_002842242.1| 40S ribosomal protein S29 [Tuber melanosporum Mel28] gi|295638503|emb|CAZ86433.1| unnamed protein product [Tuber melanosporum] Length = 56 Score = 112 bits (279), Expect = 7e-23 Identities = 49/56 (87%), Positives = 53/56 (94%) Frame = +3 Query: 57 MSHETVWFSRPRGYGKGSRSCRVCAHQAGLIRKYGLNICRQCFREKANDIGFVKNR 224 M+HETVW+SRPR YGKGSRSCRVCAH+AGLIRKYGLNICRQCFREK+ DIGFVK R Sbjct: 1 MAHETVWYSRPRSYGKGSRSCRVCAHRAGLIRKYGLNICRQCFREKSTDIGFVKMR 56 >gb|EJT97456.1| ribosomal protein S14 [Dacryopinax sp. DJM-731 SS1] Length = 56 Score = 110 bits (276), Expect = 2e-22 Identities = 48/56 (85%), Positives = 53/56 (94%) Frame = +3 Query: 57 MSHETVWFSRPRGYGKGSRSCRVCAHQAGLIRKYGLNICRQCFREKANDIGFVKNR 224 M+H++VWFSRPR YGKGSR CRVCAHQAGLIRKYGL+ICRQCFREK+ DIGFVKNR Sbjct: 1 MTHDSVWFSRPRKYGKGSRQCRVCAHQAGLIRKYGLDICRQCFREKSKDIGFVKNR 56 >emb|CCX29580.1| Similar to 40S ribosomal protein S29; acc. no. Q9C2P2 [Pyronema omphalodes CBS 100304] Length = 56 Score = 110 bits (274), Expect = 3e-22 Identities = 48/56 (85%), Positives = 52/56 (92%) Frame = +3 Query: 57 MSHETVWFSRPRGYGKGSRSCRVCAHQAGLIRKYGLNICRQCFREKANDIGFVKNR 224 M+HETVW+SRPR YGKGSR CRVCAHQAGLIRKYGLN+CRQCFREK+ DIGFVK R Sbjct: 1 MAHETVWYSRPRTYGKGSRQCRVCAHQAGLIRKYGLNVCRQCFREKSADIGFVKYR 56 >ref|XP_961514.1| 40S ribosomal protein S29 [Neurospora crassa OR74A] gi|30316288|sp|Q9C2P2.1|RS29_NEUCR RecName: Full=40S ribosomal protein S29 gi|12718270|emb|CAC28832.1| probable ribosomal protein S29.e.A, cytosolic [Neurospora crassa] gi|28923060|gb|EAA32278.1| 40S ribosomal protein S29 [Neurospora crassa OR74A] gi|336473030|gb|EGO61190.1| hypothetical protein NEUTE1DRAFT_135165 [Neurospora tetrasperma FGSC 2508] gi|350293719|gb|EGZ74804.1| putative ribosomal protein S29.e.A, cytosolic [Neurospora tetrasperma FGSC 2509] Length = 56 Score = 109 bits (273), Expect = 3e-22 Identities = 49/56 (87%), Positives = 51/56 (91%) Frame = +3 Query: 57 MSHETVWFSRPRGYGKGSRSCRVCAHQAGLIRKYGLNICRQCFREKANDIGFVKNR 224 MSHE+VW SRPR YGKGSRSCRVC H AGLIRKYGLNICRQCFREKANDIGF K+R Sbjct: 1 MSHESVWNSRPRTYGKGSRSCRVCTHSAGLIRKYGLNICRQCFREKANDIGFTKHR 56 >gb|ETI21492.1| 40S ribosomal protein S29 [Cladophialophora carrionii CBS 160.54] Length = 56 Score = 109 bits (272), Expect = 4e-22 Identities = 47/56 (83%), Positives = 52/56 (92%) Frame = +3 Query: 57 MSHETVWFSRPRGYGKGSRSCRVCAHQAGLIRKYGLNICRQCFREKANDIGFVKNR 224 MSHE+VW+SRPR YGKGSRSCRVC H AGLIRKYGLNICRQCFREK+ DIGF+K+R Sbjct: 1 MSHESVWYSRPRTYGKGSRSCRVCTHTAGLIRKYGLNICRQCFREKSQDIGFIKHR 56 >gb|ERT02119.1| 40S ribosomal protein S29 [Sporothrix schenckii ATCC 58251] Length = 56 Score = 109 bits (272), Expect = 4e-22 Identities = 48/56 (85%), Positives = 53/56 (94%) Frame = +3 Query: 57 MSHETVWFSRPRGYGKGSRSCRVCAHQAGLIRKYGLNICRQCFREKANDIGFVKNR 224 MSHE+VW SRPR YGKG+R CRVCAH+AGLIRKYGL+ICRQCFREKANDIGFVK+R Sbjct: 1 MSHESVWNSRPRSYGKGARQCRVCAHRAGLIRKYGLDICRQCFREKANDIGFVKHR 56 >gb|EMC97799.1| hypothetical protein BAUCODRAFT_155088 [Baudoinia compniacensis UAMH 10762] Length = 56 Score = 109 bits (272), Expect = 4e-22 Identities = 47/56 (83%), Positives = 52/56 (92%) Frame = +3 Query: 57 MSHETVWFSRPRGYGKGSRSCRVCAHQAGLIRKYGLNICRQCFREKANDIGFVKNR 224 MSHE+VW+SRPR YGKG+RSCRVC HQAGLIRKYGLNICRQCFREK+ DIGF K+R Sbjct: 1 MSHESVWYSRPRNYGKGARSCRVCTHQAGLIRKYGLNICRQCFREKSADIGFTKHR 56 >gb|EWC48588.1| 40S ribosomal protein S29 [Drechslerella stenobrocha 248] Length = 56 Score = 108 bits (270), Expect = 8e-22 Identities = 46/56 (82%), Positives = 52/56 (92%) Frame = +3 Query: 57 MSHETVWFSRPRGYGKGSRSCRVCAHQAGLIRKYGLNICRQCFREKANDIGFVKNR 224 M+H+ VW+SRPR YGKGSR+CRVCAHQAGLIRKYGLNICRQCFRE++ DIGF KNR Sbjct: 1 MAHDQVWYSRPRTYGKGSRACRVCAHQAGLIRKYGLNICRQCFRERSKDIGFTKNR 56 >emb|CCC10009.1| predicted 40S ribosomal protein S29 [Sordaria macrospora k-hell] Length = 56 Score = 108 bits (270), Expect = 8e-22 Identities = 48/56 (85%), Positives = 51/56 (91%) Frame = +3 Query: 57 MSHETVWFSRPRGYGKGSRSCRVCAHQAGLIRKYGLNICRQCFREKANDIGFVKNR 224 MSHE+VW SRPR YGKG+RSCRVC H AGLIRKYGLNICRQCFREKANDIGF K+R Sbjct: 1 MSHESVWNSRPRTYGKGARSCRVCTHSAGLIRKYGLNICRQCFREKANDIGFTKHR 56 >ref|XP_003299484.1| 40S ribosomal protein S29 [Pyrenophora teres f. teres 0-1] gi|311326818|gb|EFQ92418.1| hypothetical protein PTT_10485 [Pyrenophora teres f. teres 0-1] Length = 56 Score = 108 bits (270), Expect = 8e-22 Identities = 48/56 (85%), Positives = 51/56 (91%) Frame = +3 Query: 57 MSHETVWFSRPRGYGKGSRSCRVCAHQAGLIRKYGLNICRQCFREKANDIGFVKNR 224 MSHE+VW+SRPR YGKGSR CRVC H AGLIRKYGLNICRQCFREKA DIGFVK+R Sbjct: 1 MSHESVWYSRPRTYGKGSRECRVCTHPAGLIRKYGLNICRQCFREKAADIGFVKHR 56 >gb|EOA87352.1| hypothetical protein SETTUDRAFT_163319 [Setosphaeria turcica Et28A] Length = 56 Score = 108 bits (269), Expect = 1e-21 Identities = 47/56 (83%), Positives = 51/56 (91%) Frame = +3 Query: 57 MSHETVWFSRPRGYGKGSRSCRVCAHQAGLIRKYGLNICRQCFREKANDIGFVKNR 224 MSHE+VW+SRPR YGKGSR CRVC H AGLIRKYGLNICRQCFREK+ DIGFVK+R Sbjct: 1 MSHESVWYSRPRTYGKGSRECRVCTHPAGLIRKYGLNICRQCFREKSTDIGFVKHR 56 >ref|XP_003840039.1| hypothetical protein LEMA_P108250.1 [Leptosphaeria maculans JN3] gi|312216610|emb|CBX96560.1| hypothetical protein LEMA_P108250.1 [Leptosphaeria maculans JN3] Length = 118 Score = 108 bits (269), Expect = 1e-21 Identities = 50/64 (78%), Positives = 55/64 (85%) Frame = +3 Query: 33 TVPLPTAIMSHETVWFSRPRGYGKGSRSCRVCAHQAGLIRKYGLNICRQCFREKANDIGF 212 T P P IMSHE+VW+SRPR YGKG+R CRVC H AGLIRKYGLNICRQCFREK+ DIGF Sbjct: 56 TPPQPH-IMSHESVWYSRPRTYGKGARECRVCTHPAGLIRKYGLNICRQCFREKSADIGF 114 Query: 213 VKNR 224 VK+R Sbjct: 115 VKHR 118 >ref|XP_001595493.1| 40S ribosomal protein S29 [Sclerotinia sclerotiorum 1980 UF-70] gi|154701369|gb|EDO01108.1| 40S ribosomal protein S29 [Sclerotinia sclerotiorum 1980 UF-70] Length = 56 Score = 108 bits (269), Expect = 1e-21 Identities = 47/56 (83%), Positives = 52/56 (92%) Frame = +3 Query: 57 MSHETVWFSRPRGYGKGSRSCRVCAHQAGLIRKYGLNICRQCFREKANDIGFVKNR 224 MSHE+VW SRPR YGKG+R CRVC H+AGLIRKYGLNICRQCFREKA+DIGFVK+R Sbjct: 1 MSHESVWMSRPRTYGKGARGCRVCTHKAGLIRKYGLNICRQCFREKASDIGFVKHR 56 >ref|XP_001552520.1| 40S ribosomal protein S29 [Botryotinia fuckeliana B05.10] gi|347828118|emb|CCD43815.1| similar to 40S ribosomal protein S29 [Botryotinia fuckeliana T4] Length = 56 Score = 108 bits (269), Expect = 1e-21 Identities = 48/56 (85%), Positives = 51/56 (91%) Frame = +3 Query: 57 MSHETVWFSRPRGYGKGSRSCRVCAHQAGLIRKYGLNICRQCFREKANDIGFVKNR 224 MSHE+VW SRPR YGKGSR CRVC H+AGLIRKYGLNICRQCFREKA DIGFVK+R Sbjct: 1 MSHESVWMSRPRTYGKGSRECRVCTHKAGLIRKYGLNICRQCFREKAADIGFVKHR 56 >gb|ETN42172.1| 40S ribosomal protein S29 [Cyphellophora europaea CBS 101466] Length = 66 Score = 107 bits (268), Expect = 1e-21 Identities = 46/56 (82%), Positives = 51/56 (91%) Frame = +3 Query: 57 MSHETVWFSRPRGYGKGSRSCRVCAHQAGLIRKYGLNICRQCFREKANDIGFVKNR 224 MSHE+VWFSRPR YGKG+R CRVC H+AGLIRKYGLNICRQCFREK+ DIGF+K R Sbjct: 1 MSHESVWFSRPRSYGKGARGCRVCTHKAGLIRKYGLNICRQCFREKSTDIGFIKVR 56 >ref|XP_001912016.1| hypothetical protein [Podospora anserina S mat+] gi|170947040|emb|CAP73845.1| unnamed protein product [Podospora anserina S mat+] Length = 56 Score = 107 bits (268), Expect = 1e-21 Identities = 49/56 (87%), Positives = 51/56 (91%) Frame = +3 Query: 57 MSHETVWFSRPRGYGKGSRSCRVCAHQAGLIRKYGLNICRQCFREKANDIGFVKNR 224 MSHE+VW SRPR YGKGSR+CRVC HQAGLIRKYGLNICRQCFREKA DIGFVK R Sbjct: 1 MSHESVWNSRPRTYGKGSRACRVCTHQAGLIRKYGLNICRQCFREKAADIGFVKYR 56 >gb|EPQ65083.1| Protein component of the small (40S) ribosomal subunit [Blumeria graminis f. sp. tritici 96224] gi|528300960|emb|CCU75163.1| 40S ribosomal protein S29 [Blumeria graminis f. sp. hordei DH14] Length = 56 Score = 107 bits (267), Expect = 2e-21 Identities = 48/56 (85%), Positives = 52/56 (92%) Frame = +3 Query: 57 MSHETVWFSRPRGYGKGSRSCRVCAHQAGLIRKYGLNICRQCFREKANDIGFVKNR 224 MSHE VW SRPR YGKGSRSCRVC H+AGLIRKYGL+ICRQCFREKA+DIGFVK+R Sbjct: 1 MSHENVWNSRPRTYGKGSRSCRVCTHKAGLIRKYGLDICRQCFREKASDIGFVKHR 56 >gb|EME48012.1| hypothetical protein DOTSEDRAFT_21726 [Dothistroma septosporum NZE10] Length = 56 Score = 107 bits (267), Expect = 2e-21 Identities = 45/56 (80%), Positives = 52/56 (92%) Frame = +3 Query: 57 MSHETVWFSRPRGYGKGSRSCRVCAHQAGLIRKYGLNICRQCFREKANDIGFVKNR 224 MSHE+VW+SRPR YGKG+R CRVC H+AGLIRKYGLNICRQCFREK++DIGF K+R Sbjct: 1 MSHESVWYSRPRSYGKGARECRVCTHKAGLIRKYGLNICRQCFREKSSDIGFTKHR 56 >gb|EMD87813.1| hypothetical protein COCHEDRAFT_1216936 [Bipolaris maydis C5] gi|477586242|gb|ENI03327.1| hypothetical protein COCC4DRAFT_41909 [Bipolaris maydis ATCC 48331] gi|576917146|gb|EUC31379.1| hypothetical protein COCCADRAFT_6728 [Bipolaris zeicola 26-R-13] gi|576936494|gb|EUC49989.1| hypothetical protein COCMIDRAFT_1391 [Bipolaris oryzae ATCC 44560] gi|578488927|gb|EUN26365.1| hypothetical protein COCVIDRAFT_27200 [Bipolaris victoriae FI3] Length = 56 Score = 107 bits (267), Expect = 2e-21 Identities = 47/56 (83%), Positives = 51/56 (91%) Frame = +3 Query: 57 MSHETVWFSRPRGYGKGSRSCRVCAHQAGLIRKYGLNICRQCFREKANDIGFVKNR 224 MSHE+VW+SRPR YGKGSR CRVC H AGLIRKYGLNICRQCFREK+ DIGFVK+R Sbjct: 1 MSHESVWYSRPRTYGKGSRECRVCTHPAGLIRKYGLNICRQCFREKSADIGFVKHR 56 >ref|XP_003855365.1| 40S ribosomal protein S29 [Zymoseptoria tritici IPO323] gi|339475249|gb|EGP90341.1| hypothetical protein MYCGRDRAFT_103406 [Zymoseptoria tritici IPO323] Length = 56 Score = 107 bits (267), Expect = 2e-21 Identities = 47/56 (83%), Positives = 50/56 (89%) Frame = +3 Query: 57 MSHETVWFSRPRGYGKGSRSCRVCAHQAGLIRKYGLNICRQCFREKANDIGFVKNR 224 MSHE+VW+ RPR YGKGSR CRVC HQAGLIRKYGLNICRQCFREKA DIGF K+R Sbjct: 1 MSHESVWYCRPRTYGKGSRECRVCTHQAGLIRKYGLNICRQCFREKAADIGFTKHR 56