BLASTX nr result
ID: Akebia25_contig00010771
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00010771 (345 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007146443.1| hypothetical protein PHAVU_006G040900g [Phas... 62 1e-07 ref|XP_007021141.1| Nbs-lrr resistance protein, putative isoform... 60 4e-07 ref|XP_006403969.1| hypothetical protein EUTSA_v10010117mg [Eutr... 58 2e-06 dbj|BAJ34431.1| unnamed protein product [Thellungiella halophila] 58 2e-06 ref|XP_006466847.1| PREDICTED: disease resistance RPP13-like pro... 57 3e-06 ref|XP_006425621.1| hypothetical protein CICLE_v10024885mg [Citr... 57 3e-06 gb|ACP30629.1| disease resistance protein [Brassica rapa subsp. ... 57 3e-06 gb|ACP30594.1| disease resistance protein [Brassica rapa subsp. ... 57 3e-06 gb|ABF73792.1| disease resistance protein [Arabidopsis thaliana] 56 4e-06 gb|ABF73772.1| disease resistance protein [Arabidopsis thaliana] 56 6e-06 gb|ABF73824.1| disease resistance protein [Arabidopsis thaliana] 56 6e-06 gb|ABF73763.1| disease resistance protein [Arabidopsis thaliana]... 56 6e-06 gb|ABF73757.1| disease resistance protein [Arabidopsis thaliana]... 56 6e-06 ref|XP_006603238.1| PREDICTED: disease resistance RPP13-like pro... 55 8e-06 ref|XP_002317252.2| hypothetical protein POPTR_0011s04040g [Popu... 55 8e-06 gb|AAA63149.1| myosin heavy chain homolog, partial [Arabidopsis ... 55 8e-06 ref|NP_190664.1| protein HOPZ-ACTIVATED RESISTANCE 1 [Arabidopsi... 55 8e-06 gb|ABF73758.1| disease resistance protein [Arabidopsis thaliana]... 55 8e-06 gb|ABF73813.1| disease resistance protein [Arabidopsis thaliana] 55 8e-06 gb|ABF73770.1| disease resistance protein [Arabidopsis thaliana] 55 8e-06 >ref|XP_007146443.1| hypothetical protein PHAVU_006G040900g [Phaseolus vulgaris] gi|561019666|gb|ESW18437.1| hypothetical protein PHAVU_006G040900g [Phaseolus vulgaris] Length = 577 Score = 61.6 bits (148), Expect = 1e-07 Identities = 36/94 (38%), Positives = 55/94 (58%), Gaps = 1/94 (1%) Frame = +1 Query: 1 LPKNMASLEKLCTLDLFGCESIEFLPSEIGNLRQLCIFS-FTVNSKVKDGFRISGLKNLT 177 LPKN+AS++ L LD+ C ++ +P I L QL + F + S K RIS L NL Sbjct: 384 LPKNIASMKSLTHLDVSECYLLDSMPRGIEKLTQLQVLKGFVIGSSSKTPCRISDLANLK 443 Query: 178 QIKKLAIDIGAEDGIEERELKVLSELTQLEWLCI 279 ++K+ ++ IG+E I++ E + L ELT + L I Sbjct: 444 KLKRFSVHIGSEAVIQDMEFESLKELTAVNCLKI 477 >ref|XP_007021141.1| Nbs-lrr resistance protein, putative isoform 1 [Theobroma cacao] gi|590607987|ref|XP_007021142.1| Nbs-lrr resistance protein, putative isoform 1 [Theobroma cacao] gi|590607991|ref|XP_007021143.1| Nbs-lrr resistance protein, putative isoform 1 [Theobroma cacao] gi|590607994|ref|XP_007021144.1| Nbs-lrr resistance protein, putative isoform 1 [Theobroma cacao] gi|508720769|gb|EOY12666.1| Nbs-lrr resistance protein, putative isoform 1 [Theobroma cacao] gi|508720770|gb|EOY12667.1| Nbs-lrr resistance protein, putative isoform 1 [Theobroma cacao] gi|508720771|gb|EOY12668.1| Nbs-lrr resistance protein, putative isoform 1 [Theobroma cacao] gi|508720772|gb|EOY12669.1| Nbs-lrr resistance protein, putative isoform 1 [Theobroma cacao] Length = 846 Score = 59.7 bits (143), Expect = 4e-07 Identities = 40/95 (42%), Positives = 58/95 (61%), Gaps = 2/95 (2%) Frame = +1 Query: 1 LPKNMASLEKLCTLDLFGCESIEFLPSEIGNLRQLCIFS-FTVNSKV-KDGFRISGLKNL 174 LP ++ +L+KL LD+ C I++LP +G L L S FTV S ++G R+ L+ L Sbjct: 627 LPSSITNLQKLNVLDIGYCP-IQYLPQGLGRLSNLQELSGFTVPSAADRNGCRLGELQGL 685 Query: 175 TQIKKLAIDIGAEDGIEERELKVLSELTQLEWLCI 279 +Q+K L ++I E I E+EL VLS L QL+ L I Sbjct: 686 SQLKVLRVNISEESDIAEQELTVLSRLKQLKVLSI 720 >ref|XP_006403969.1| hypothetical protein EUTSA_v10010117mg [Eutrema salsugineum] gi|557105088|gb|ESQ45422.1| hypothetical protein EUTSA_v10010117mg [Eutrema salsugineum] Length = 853 Score = 57.8 bits (138), Expect = 2e-06 Identities = 34/107 (31%), Positives = 59/107 (55%) Frame = +1 Query: 25 EKLCTLDLFGCESIEFLPSEIGNLRQLCIFSFTVNSKVKDGFRISGLKNLTQIKKLAIDI 204 +KL LD+ C S+E+ P IG+L L + S+ +G ++S ++NLT ++KL + + Sbjct: 634 KKLLVLDMTNCGSLEYFPKGIGSLGNLEVLLGFKPSRSNNGCKLSEVRNLTNLRKLGLSL 693 Query: 205 GAEDGIEERELKVLSELTQLEWLCIRFPSNINIIVVEKDRLLSPLNQ 345 D IEE EL L L++L ++ I + ++ K L+P +Q Sbjct: 694 TRGDQIEEDELDSLINLSKLMFISINCYDSYGDDLITKLDALTPPHQ 740 >dbj|BAJ34431.1| unnamed protein product [Thellungiella halophila] Length = 669 Score = 57.8 bits (138), Expect = 2e-06 Identities = 34/107 (31%), Positives = 59/107 (55%) Frame = +1 Query: 25 EKLCTLDLFGCESIEFLPSEIGNLRQLCIFSFTVNSKVKDGFRISGLKNLTQIKKLAIDI 204 +KL LD+ C S+E+ P IG+L L + S+ +G ++S ++NLT ++KL + + Sbjct: 450 KKLLVLDMTNCGSLEYFPKGIGSLGNLEVLLGFKPSRSNNGCKLSEVRNLTNLRKLGLSL 509 Query: 205 GAEDGIEERELKVLSELTQLEWLCIRFPSNINIIVVEKDRLLSPLNQ 345 D IEE EL L L++L ++ I + ++ K L+P +Q Sbjct: 510 TRGDQIEEDELDSLINLSKLMFISINCYDSYGDDLITKLDALTPPHQ 556 >ref|XP_006466847.1| PREDICTED: disease resistance RPP13-like protein 4-like isoform X1 [Citrus sinensis] gi|568824938|ref|XP_006466848.1| PREDICTED: disease resistance RPP13-like protein 4-like isoform X2 [Citrus sinensis] gi|568824940|ref|XP_006466849.1| PREDICTED: disease resistance RPP13-like protein 4-like isoform X3 [Citrus sinensis] Length = 849 Score = 56.6 bits (135), Expect = 3e-06 Identities = 41/114 (35%), Positives = 59/114 (51%), Gaps = 2/114 (1%) Frame = +1 Query: 1 LPKNMASLEKLCTLDLFGCESIEFLPSEIGNLRQL-CIFSFT-VNSKVKDGFRISGLKNL 174 LP + S +L LD+ C S+++LP G L L + F S +G RIS LKNL Sbjct: 625 LPSYVQSFIQLRALDVTHCGSLQYLPKGFGKLLNLEVLLGFRPARSSQPEGCRISELKNL 684 Query: 175 TQIKKLAIDIGAEDGIEERELKVLSELTQLEWLCIRFPSNINIIVVEKDRLLSP 336 T+++KL + + D IEE L L EL L C F S+ + ++ + D L P Sbjct: 685 TRLRKLGLQLTCGDEIEEDALVNLRELQFLSISC--FDSHGSDLIAKIDELYPP 736 >ref|XP_006425621.1| hypothetical protein CICLE_v10024885mg [Citrus clementina] gi|557527611|gb|ESR38861.1| hypothetical protein CICLE_v10024885mg [Citrus clementina] Length = 849 Score = 56.6 bits (135), Expect = 3e-06 Identities = 41/114 (35%), Positives = 59/114 (51%), Gaps = 2/114 (1%) Frame = +1 Query: 1 LPKNMASLEKLCTLDLFGCESIEFLPSEIGNLRQL-CIFSFT-VNSKVKDGFRISGLKNL 174 LP + S +L LD+ C S+++LP G L L + F S +G RIS LKNL Sbjct: 625 LPSYVQSFIQLRALDVTHCGSLQYLPKGFGKLLNLEVLLGFRPARSSQPEGCRISELKNL 684 Query: 175 TQIKKLAIDIGAEDGIEERELKVLSELTQLEWLCIRFPSNINIIVVEKDRLLSP 336 T+++KL + + D IEE L L EL L C F S+ + ++ + D L P Sbjct: 685 TRLRKLGLQLTCGDEIEEDALVNLRELQFLSISC--FDSHGSDLIAKIDELYPP 736 >gb|ACP30629.1| disease resistance protein [Brassica rapa subsp. pekinensis] Length = 858 Score = 56.6 bits (135), Expect = 3e-06 Identities = 35/107 (32%), Positives = 57/107 (53%) Frame = +1 Query: 25 EKLCTLDLFGCESIEFLPSEIGNLRQLCIFSFTVNSKVKDGFRISGLKNLTQIKKLAIDI 204 +KL LD+ C S+E+ P IG+L L + S +G ++S ++NLT ++KL + + Sbjct: 639 KKLLVLDMTNCGSLEYFPKGIGSLGNLEVLLGFKPSMSSNGCKLSEVRNLTNLRKLGLSL 698 Query: 205 GAEDGIEERELKVLSELTQLEWLCIRFPSNINIIVVEKDRLLSPLNQ 345 D IEE EL L L++L L I + ++ K L+P +Q Sbjct: 699 TRGDQIEEDELDSLVNLSKLMLLSINCYDSYGDNLITKIDALTPPHQ 745 >gb|ACP30594.1| disease resistance protein [Brassica rapa subsp. pekinensis] Length = 589 Score = 56.6 bits (135), Expect = 3e-06 Identities = 35/107 (32%), Positives = 57/107 (53%) Frame = +1 Query: 25 EKLCTLDLFGCESIEFLPSEIGNLRQLCIFSFTVNSKVKDGFRISGLKNLTQIKKLAIDI 204 +KL LD+ C S+E+ P IG+L L + S +G ++S ++NLT ++KL + + Sbjct: 450 KKLLVLDMTNCGSLEYFPKGIGSLGNLEVLLGFKPSMSSNGCKLSEVRNLTNLRKLGLSL 509 Query: 205 GAEDGIEERELKVLSELTQLEWLCIRFPSNINIIVVEKDRLLSPLNQ 345 D IEE EL L L++L L I + ++ K L+P +Q Sbjct: 510 TRGDQIEEDELDSLVNLSKLMLLSINCYDSYGDNLITKIDALTPPHQ 556 >gb|ABF73792.1| disease resistance protein [Arabidopsis thaliana] Length = 297 Score = 56.2 bits (134), Expect = 4e-06 Identities = 35/106 (33%), Positives = 59/106 (55%), Gaps = 1/106 (0%) Frame = +1 Query: 25 EKLCTLDLFGCESIEFLPSEIGNLRQLCIFSFTVNSKVKDGFRISGLKNLTQIKKLAIDI 204 +KL LD+ C S+E P IG+L +L + ++ +G ++S +KNLT ++KL + + Sbjct: 79 KKLLVLDMTNCGSLECFPKGIGSLVKLEVLLGFKPARXNNGCKLSEVKNLTNLRKLGLSL 138 Query: 205 GAEDGIEERELKVLSELTQLEWLCIR-FPSNINIIVVEKDRLLSPL 339 D IEE EL L L++L + I + S + ++ + D L PL Sbjct: 139 TRGDQIEEEELDSLINLSKLMSISINCYDSYGDDLITKIDALTPPL 184 >gb|ABF73772.1| disease resistance protein [Arabidopsis thaliana] Length = 297 Score = 55.8 bits (133), Expect = 6e-06 Identities = 35/106 (33%), Positives = 59/106 (55%), Gaps = 1/106 (0%) Frame = +1 Query: 25 EKLCTLDLFGCESIEFLPSEIGNLRQLCIFSFTVNSKVKDGFRISGLKNLTQIKKLAIDI 204 +KL LD+ C S+E P IG+L +L + ++ +G ++S +KNLT ++KL + + Sbjct: 79 KKLLVLDMTNCGSLECFPKGIGSLVKLEVLLGFKPARSNNGCKLSEVKNLTNLRKLGLSL 138 Query: 205 GAEDGIEERELKVLSELTQLEWLCIR-FPSNINIIVVEKDRLLSPL 339 D IEE EL L L++L + I + S + ++ + D L PL Sbjct: 139 TRGDQIEEEELDSLINLSKLMSISINCYDSYGDDLITKIDALTPPL 184 >gb|ABF73824.1| disease resistance protein [Arabidopsis thaliana] Length = 297 Score = 55.8 bits (133), Expect = 6e-06 Identities = 35/106 (33%), Positives = 59/106 (55%), Gaps = 1/106 (0%) Frame = +1 Query: 25 EKLCTLDLFGCESIEFLPSEIGNLRQLCIFSFTVNSKVKDGFRISGLKNLTQIKKLAIDI 204 +KL LD+ C S+E P IG+L +L + ++ +G ++S +KNLT ++KL + + Sbjct: 79 KKLLVLDMTNCGSLECFPKGIGSLVKLEVLLGFKPARSNNGCKLSEVKNLTNLRKLGLSL 138 Query: 205 GAEDGIEERELKVLSELTQLEWLCIR-FPSNINIIVVEKDRLLSPL 339 D IEE EL L L++L + I + S + ++ + D L PL Sbjct: 139 TRGDQIEEEELDSLINLSKLMSISINCYDSYGDDLITKIDALTPPL 184 >gb|ABF73763.1| disease resistance protein [Arabidopsis thaliana] gi|104646167|gb|ABF73764.1| disease resistance protein [Arabidopsis thaliana] gi|104646199|gb|ABF73780.1| disease resistance protein [Arabidopsis thaliana] gi|104646233|gb|ABF73797.1| disease resistance protein [Arabidopsis thaliana] gi|104646255|gb|ABF73808.1| disease resistance protein [Arabidopsis thaliana] gi|104646267|gb|ABF73814.1| disease resistance protein [Arabidopsis thaliana] Length = 297 Score = 55.8 bits (133), Expect = 6e-06 Identities = 35/106 (33%), Positives = 59/106 (55%), Gaps = 1/106 (0%) Frame = +1 Query: 25 EKLCTLDLFGCESIEFLPSEIGNLRQLCIFSFTVNSKVKDGFRISGLKNLTQIKKLAIDI 204 +KL LD+ C S+E P IG+L +L + ++ +G ++S +KNLT ++KL + + Sbjct: 79 KKLLVLDMTNCGSLECFPKGIGSLVKLEVLLGFKPARSNNGCKLSEVKNLTNLRKLGLSL 138 Query: 205 GAEDGIEERELKVLSELTQLEWLCIR-FPSNINIIVVEKDRLLSPL 339 D IEE EL L L++L + I + S + ++ + D L PL Sbjct: 139 TRGDQIEEEELDSLINLSKLMSISINCYDSYGDDLITKIDALTPPL 184 >gb|ABF73757.1| disease resistance protein [Arabidopsis thaliana] gi|104646157|gb|ABF73759.1| disease resistance protein [Arabidopsis thaliana] gi|104646159|gb|ABF73760.1| disease resistance protein [Arabidopsis thaliana] gi|104646163|gb|ABF73762.1| disease resistance protein [Arabidopsis thaliana] gi|104646175|gb|ABF73768.1| disease resistance protein [Arabidopsis thaliana] gi|104646177|gb|ABF73769.1| disease resistance protein [Arabidopsis thaliana] gi|104646181|gb|ABF73771.1| disease resistance protein [Arabidopsis thaliana] gi|104646187|gb|ABF73774.1| disease resistance protein [Arabidopsis thaliana] gi|104646189|gb|ABF73775.1| disease resistance protein [Arabidopsis thaliana] gi|104646191|gb|ABF73776.1| disease resistance protein [Arabidopsis thaliana] gi|104646195|gb|ABF73778.1| disease resistance protein [Arabidopsis thaliana] gi|104646211|gb|ABF73786.1| disease resistance protein [Arabidopsis thaliana] gi|104646213|gb|ABF73787.1| disease resistance protein [Arabidopsis thaliana] gi|104646215|gb|ABF73788.1| disease resistance protein [Arabidopsis thaliana] gi|104646221|gb|ABF73791.1| disease resistance protein [Arabidopsis thaliana] gi|104646237|gb|ABF73799.1| disease resistance protein [Arabidopsis thaliana] gi|104646241|gb|ABF73801.1| disease resistance protein [Arabidopsis thaliana] gi|104646251|gb|ABF73806.1| disease resistance protein [Arabidopsis thaliana] gi|104646257|gb|ABF73809.1| disease resistance protein [Arabidopsis thaliana] gi|104646263|gb|ABF73812.1| disease resistance protein [Arabidopsis thaliana] gi|104646275|gb|ABF73818.1| disease resistance protein [Arabidopsis thaliana] gi|104646277|gb|ABF73819.1| disease resistance protein [Arabidopsis thaliana] gi|104646279|gb|ABF73820.1| disease resistance protein [Arabidopsis thaliana] gi|104646281|gb|ABF73821.1| disease resistance protein [Arabidopsis thaliana] gi|104646283|gb|ABF73822.1| disease resistance protein [Arabidopsis thaliana] gi|104646285|gb|ABF73823.1| disease resistance protein [Arabidopsis thaliana] gi|104646291|gb|ABF73826.1| disease resistance protein [Arabidopsis thaliana] gi|104646293|gb|ABF73827.1| disease resistance protein [Arabidopsis thaliana] gi|104646297|gb|ABF73829.1| disease resistance protein [Arabidopsis thaliana] Length = 297 Score = 55.8 bits (133), Expect = 6e-06 Identities = 35/106 (33%), Positives = 59/106 (55%), Gaps = 1/106 (0%) Frame = +1 Query: 25 EKLCTLDLFGCESIEFLPSEIGNLRQLCIFSFTVNSKVKDGFRISGLKNLTQIKKLAIDI 204 +KL LD+ C S+E P IG+L +L + ++ +G ++S +KNLT ++KL + + Sbjct: 79 KKLLVLDMTNCGSLECFPKGIGSLVKLEVLLGFKPARSNNGCKLSEVKNLTNLRKLGLSL 138 Query: 205 GAEDGIEERELKVLSELTQLEWLCIR-FPSNINIIVVEKDRLLSPL 339 D IEE EL L L++L + I + S + ++ + D L PL Sbjct: 139 TRGDQIEEEELDSLINLSKLMSISINCYDSYGDDLITKIDALTPPL 184 >ref|XP_006603238.1| PREDICTED: disease resistance RPP13-like protein 4-like [Glycine max] Length = 531 Score = 55.5 bits (132), Expect = 8e-06 Identities = 36/118 (30%), Positives = 61/118 (51%), Gaps = 25/118 (21%) Frame = +1 Query: 1 LPKNMASLEKLCTLDLFGCESIEFLPSEIGNLRQL------------------------- 105 LP ++ LE L TLDL C ++E LP++I +LR L Sbjct: 329 LPLSIFQLESLETLDLKACHNLETLPNDIASLRNLRHLDLSQCYLLDRMPKGIEKLAKLE 388 Query: 106 CIFSFTVNSKVKDGFRISGLKNLTQIKKLAIDIGAEDGIEERELKVLSELTQLEWLCI 279 + F + S +K +S L +L+++K+L+I IG+ I+++E + L +L++LE L I Sbjct: 389 VLKGFVIGSSIKTPCNVSDLAHLSKLKQLSIHIGSGAVIQDKEFESLEKLSELEKLKI 446 >ref|XP_002317252.2| hypothetical protein POPTR_0011s04040g [Populus trichocarpa] gi|550327546|gb|EEE97864.2| hypothetical protein POPTR_0011s04040g [Populus trichocarpa] Length = 818 Score = 55.5 bits (132), Expect = 8e-06 Identities = 30/97 (30%), Positives = 57/97 (58%), Gaps = 2/97 (2%) Frame = +1 Query: 1 LPKNMASLEKLCTLDLFGCESIEFLPSEIGNLRQLCIFSFTV--NSKVKDGFRISGLKNL 174 +P+N+ SL+KL LD+ C ++++P +G+L +L + V N K+K+ + L+ L Sbjct: 559 IPENIVSLQKLTHLDISECYMLDYMPKGLGSLTELQVLKGFVISNLKIKNAGTLDDLRGL 618 Query: 175 TQIKKLAIDIGAEDGIEERELKVLSELTQLEWLCIRF 285 +++KL+I +D ++LK L +T L+ L I + Sbjct: 619 PKLRKLSIYTTKKDFPRVQDLKALRHITALQKLTIEW 655 >gb|AAA63149.1| myosin heavy chain homolog, partial [Arabidopsis thaliana] Length = 904 Score = 55.5 bits (132), Expect = 8e-06 Identities = 34/107 (31%), Positives = 58/107 (54%) Frame = +1 Query: 25 EKLCTLDLFGCESIEFLPSEIGNLRQLCIFSFTVNSKVKDGFRISGLKNLTQIKKLAIDI 204 +KL LD+ C S+E P IG+L +L + ++ +G ++S +KNLT ++KL + + Sbjct: 686 KKLLVLDMTNCGSLECFPKGIGSLVKLEVLLGFKPARSNNGCKLSEVKNLTNLRKLGLSL 745 Query: 205 GAEDGIEERELKVLSELTQLEWLCIRFPSNINIIVVEKDRLLSPLNQ 345 D IEE EL L L++L + I + ++ K L+P +Q Sbjct: 746 TRGDQIEEEELDSLINLSKLMSISINCYDSYGDDLITKIDALTPPHQ 792 >ref|NP_190664.1| protein HOPZ-ACTIVATED RESISTANCE 1 [Arabidopsis thaliana] gi|30693383|ref|NP_850677.1| protein HOPZ-ACTIVATED RESISTANCE 1 [Arabidopsis thaliana] gi|29839509|sp|Q38834.2|R13L4_ARATH RecName: Full=Disease resistance RPP13-like protein 4 gi|4835246|emb|CAB42924.1| putative disease resistance protein [Arabidopsis thaliana] gi|110742313|dbj|BAE99081.1| putative disease resistance protein [Arabidopsis thaliana] gi|332645209|gb|AEE78730.1| disease resistance RPP13-like protein 4 [Arabidopsis thaliana] gi|332645210|gb|AEE78731.1| disease resistance RPP13-like protein 4 [Arabidopsis thaliana] Length = 852 Score = 55.5 bits (132), Expect = 8e-06 Identities = 34/107 (31%), Positives = 58/107 (54%) Frame = +1 Query: 25 EKLCTLDLFGCESIEFLPSEIGNLRQLCIFSFTVNSKVKDGFRISGLKNLTQIKKLAIDI 204 +KL LD+ C S+E P IG+L +L + ++ +G ++S +KNLT ++KL + + Sbjct: 634 KKLLVLDMTNCGSLECFPKGIGSLVKLEVLLGFKPARSNNGCKLSEVKNLTNLRKLGLSL 693 Query: 205 GAEDGIEERELKVLSELTQLEWLCIRFPSNINIIVVEKDRLLSPLNQ 345 D IEE EL L L++L + I + ++ K L+P +Q Sbjct: 694 TRGDQIEEEELDSLINLSKLMSISINCYDSYGDDLITKIDALTPPHQ 740 >gb|ABF73758.1| disease resistance protein [Arabidopsis thaliana] gi|104646161|gb|ABF73761.1| disease resistance protein [Arabidopsis thaliana] gi|104646169|gb|ABF73765.1| disease resistance protein [Arabidopsis thaliana] gi|104646171|gb|ABF73766.1| disease resistance protein [Arabidopsis thaliana] gi|104646173|gb|ABF73767.1| disease resistance protein [Arabidopsis thaliana] gi|104646185|gb|ABF73773.1| disease resistance protein [Arabidopsis thaliana] gi|104646193|gb|ABF73777.1| disease resistance protein [Arabidopsis thaliana] gi|104646197|gb|ABF73779.1| disease resistance protein [Arabidopsis thaliana] gi|104646201|gb|ABF73781.1| disease resistance protein [Arabidopsis thaliana] gi|104646203|gb|ABF73782.1| disease resistance protein [Arabidopsis thaliana] gi|104646205|gb|ABF73783.1| disease resistance protein [Arabidopsis thaliana] gi|104646207|gb|ABF73784.1| disease resistance protein [Arabidopsis thaliana] gi|104646209|gb|ABF73785.1| disease resistance protein [Arabidopsis thaliana] gi|104646217|gb|ABF73789.1| disease resistance protein [Arabidopsis thaliana] gi|104646219|gb|ABF73790.1| disease resistance protein [Arabidopsis thaliana] gi|104646225|gb|ABF73793.1| disease resistance protein [Arabidopsis thaliana] gi|104646227|gb|ABF73794.1| disease resistance protein [Arabidopsis thaliana] gi|104646229|gb|ABF73795.1| disease resistance protein [Arabidopsis thaliana] gi|104646231|gb|ABF73796.1| disease resistance protein [Arabidopsis thaliana] gi|104646235|gb|ABF73798.1| disease resistance protein [Arabidopsis thaliana] gi|104646239|gb|ABF73800.1| disease resistance protein [Arabidopsis thaliana] gi|104646243|gb|ABF73802.1| disease resistance protein [Arabidopsis thaliana] gi|104646245|gb|ABF73803.1| disease resistance protein [Arabidopsis thaliana] gi|104646247|gb|ABF73804.1| disease resistance protein [Arabidopsis thaliana] gi|104646249|gb|ABF73805.1| disease resistance protein [Arabidopsis thaliana] gi|104646253|gb|ABF73807.1| disease resistance protein [Arabidopsis thaliana] gi|104646259|gb|ABF73810.1| disease resistance protein [Arabidopsis thaliana] gi|104646261|gb|ABF73811.1| disease resistance protein [Arabidopsis thaliana] gi|104646269|gb|ABF73815.1| disease resistance protein [Arabidopsis thaliana] gi|104646271|gb|ABF73816.1| disease resistance protein [Arabidopsis thaliana] gi|104646273|gb|ABF73817.1| disease resistance protein [Arabidopsis thaliana] gi|104646289|gb|ABF73825.1| disease resistance protein [Arabidopsis thaliana] gi|104646295|gb|ABF73828.1| disease resistance protein [Arabidopsis thaliana] Length = 297 Score = 55.5 bits (132), Expect = 8e-06 Identities = 34/107 (31%), Positives = 58/107 (54%) Frame = +1 Query: 25 EKLCTLDLFGCESIEFLPSEIGNLRQLCIFSFTVNSKVKDGFRISGLKNLTQIKKLAIDI 204 +KL LD+ C S+E P IG+L +L + ++ +G ++S +KNLT ++KL + + Sbjct: 79 KKLLVLDMTNCGSLECFPKGIGSLVKLEVLLGFKPARSNNGCKLSEVKNLTNLRKLGLSL 138 Query: 205 GAEDGIEERELKVLSELTQLEWLCIRFPSNINIIVVEKDRLLSPLNQ 345 D IEE EL L L++L + I + ++ K L+P +Q Sbjct: 139 TRGDQIEEEELDSLINLSKLMSISINCYDSYGDDLITKIDALTPPHQ 185 >gb|ABF73813.1| disease resistance protein [Arabidopsis thaliana] Length = 297 Score = 55.5 bits (132), Expect = 8e-06 Identities = 34/107 (31%), Positives = 58/107 (54%) Frame = +1 Query: 25 EKLCTLDLFGCESIEFLPSEIGNLRQLCIFSFTVNSKVKDGFRISGLKNLTQIKKLAIDI 204 +KL LD+ C S+E P IG+L +L + ++ +G ++S +KNLT ++KL + + Sbjct: 79 KKLLVLDMTNCGSLECFPKGIGSLVKLEVLLGFKPARSNNGCKLSEVKNLTNLRKLGLSL 138 Query: 205 GAEDGIEERELKVLSELTQLEWLCIRFPSNINIIVVEKDRLLSPLNQ 345 D IEE EL L L++L + I + ++ K L+P +Q Sbjct: 139 TRGDQIEEEELDSLINLSKLMSISINCYDSYGDDLITKIDALTPPHQ 185 >gb|ABF73770.1| disease resistance protein [Arabidopsis thaliana] Length = 297 Score = 55.5 bits (132), Expect = 8e-06 Identities = 34/107 (31%), Positives = 58/107 (54%) Frame = +1 Query: 25 EKLCTLDLFGCESIEFLPSEIGNLRQLCIFSFTVNSKVKDGFRISGLKNLTQIKKLAIDI 204 +KL LD+ C S+E P IG+L +L + ++ +G ++S +KNLT ++KL + + Sbjct: 79 KKLLVLDMTNCGSLECFPKGIGSLVKLEVLLGFKPARSNNGCKLSEVKNLTNLRKLGLSL 138 Query: 205 GAEDGIEERELKVLSELTQLEWLCIRFPSNINIIVVEKDRLLSPLNQ 345 D IEE EL L L++L + I + ++ K L+P +Q Sbjct: 139 TRGDQIEEEELDSLINLSKLMSISINCYDSYGDDLITKIDALTPPHQ 185