BLASTX nr result
ID: Akebia25_contig00010527
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00010527 (1091 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006844724.1| hypothetical protein AMTR_s00016p00253230 [A... 65 7e-08 >ref|XP_006844724.1| hypothetical protein AMTR_s00016p00253230 [Amborella trichopoda] gi|548847195|gb|ERN06399.1| hypothetical protein AMTR_s00016p00253230 [Amborella trichopoda] Length = 93 Score = 64.7 bits (156), Expect = 7e-08 Identities = 28/52 (53%), Positives = 34/52 (65%) Frame = -3 Query: 873 KEAIKRTWSSNDSMGHGNGSKACVCAPTTHAGSFKCRLHRV*NEYFTFYVHH 718 K +KRTWS++ G +ACVCAPTTHAGSF+CRLHRV + HH Sbjct: 17 KGTMKRTWSNDSLSGQSGAPRACVCAPTTHAGSFRCRLHRVNSHGHQHQSHH 68