BLASTX nr result
ID: Akebia25_contig00010335
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00010335 (397 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007051510.1| Uncharacterized protein TCM_005116 [Theobrom... 75 1e-11 ref|XP_002301419.2| hypothetical protein POPTR_0002s17440g [Popu... 69 5e-10 ref|XP_002523315.1| conserved hypothetical protein [Ricinus comm... 62 6e-08 ref|XP_002275967.1| PREDICTED: uncharacterized protein LOC100258... 61 1e-07 ref|XP_007209814.1| hypothetical protein PRUPE_ppa014288mg [Prun... 60 4e-07 ref|XP_007039111.1| Uncharacterized protein TCM_015451 [Theobrom... 57 2e-06 gb|EYU32268.1| hypothetical protein MIMGU_mgv1a017083mg [Mimulus... 57 3e-06 ref|XP_006444809.1| hypothetical protein CICLE_v10022804mg [Citr... 57 3e-06 gb|ABK23823.1| unknown [Picea sitchensis] 57 3e-06 gb|EYU25255.1| hypothetical protein MIMGU_mgv1a015858mg [Mimulus... 56 5e-06 ref|XP_004145950.1| PREDICTED: uncharacterized protein LOC101207... 56 5e-06 gb|AEW09087.1| hypothetical protein CL3702Contig1_01, partial [P... 56 5e-06 ref|XP_002518873.1| conserved hypothetical protein [Ricinus comm... 56 6e-06 >ref|XP_007051510.1| Uncharacterized protein TCM_005116 [Theobroma cacao] gi|508703771|gb|EOX95667.1| Uncharacterized protein TCM_005116 [Theobroma cacao] Length = 88 Score = 74.7 bits (182), Expect = 1e-11 Identities = 36/45 (80%), Positives = 39/45 (86%) Frame = -2 Query: 396 ASAFFASLERFSCINLSTTDVEDEEEARDRPLMLTNPVVQDGPET 262 ASAFFASLER SCINLSTTD +DEEEA+DRPLMLT P+V D ET Sbjct: 25 ASAFFASLERCSCINLSTTDFDDEEEAKDRPLMLTKPIVHDETET 69 >ref|XP_002301419.2| hypothetical protein POPTR_0002s17440g [Populus trichocarpa] gi|550345221|gb|EEE80692.2| hypothetical protein POPTR_0002s17440g [Populus trichocarpa] Length = 96 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = -2 Query: 396 ASAFFASLERFSCINLSTTDVEDEEEARDRPLMLTNPVVQD 274 ASAFFASLER SCINL+TTD+ED+EEARDRPLMLT P D Sbjct: 38 ASAFFASLERCSCINLNTTDLEDDEEARDRPLMLTKPSAHD 78 >ref|XP_002523315.1| conserved hypothetical protein [Ricinus communis] gi|223537403|gb|EEF39031.1| conserved hypothetical protein [Ricinus communis] Length = 88 Score = 62.4 bits (150), Expect = 6e-08 Identities = 31/46 (67%), Positives = 38/46 (82%), Gaps = 1/46 (2%) Frame = -2 Query: 396 ASAFFASLERFSCINLSTTDVE-DEEEARDRPLMLTNPVVQDGPET 262 ASAFFASLER SCINL+T D E D+EEA+DRPLML+ P V+D ++ Sbjct: 29 ASAFFASLERCSCINLNTADPEDDDEEAKDRPLMLSKPTVRDNSDS 74 >ref|XP_002275967.1| PREDICTED: uncharacterized protein LOC100258972 [Vitis vinifera] Length = 75 Score = 61.2 bits (147), Expect = 1e-07 Identities = 36/57 (63%), Positives = 44/57 (77%), Gaps = 4/57 (7%) Frame = -2 Query: 396 ASAFFASLERFSCINLSTTDVEDE----EEARDRPLMLTNPVVQDGPETNDVNKLPV 238 ASAFFASLER SCINLST D++D+ EEA+DRPLMLTN + P+++ VN LPV Sbjct: 24 ASAFFASLERCSCINLSTADMDDDNDDGEEAKDRPLMLTN----ESPKSDVVN-LPV 75 >ref|XP_007209814.1| hypothetical protein PRUPE_ppa014288mg [Prunus persica] gi|462405549|gb|EMJ11013.1| hypothetical protein PRUPE_ppa014288mg [Prunus persica] Length = 76 Score = 59.7 bits (143), Expect = 4e-07 Identities = 34/55 (61%), Positives = 41/55 (74%), Gaps = 2/55 (3%) Frame = -2 Query: 396 ASAFFASLERFSCINLSTTDV--EDEEEARDRPLMLTNPVVQDGPETNDVNKLPV 238 ++AFF+SLERFSC+NL+TTD EDE+EA DRP LTN D P NDV +LPV Sbjct: 26 STAFFSSLERFSCVNLATTDFDDEDEDEAADRPFTLTNH--SDPP--NDVAELPV 76 >ref|XP_007039111.1| Uncharacterized protein TCM_015451 [Theobroma cacao] gi|508776356|gb|EOY23612.1| Uncharacterized protein TCM_015451 [Theobroma cacao] Length = 80 Score = 57.4 bits (137), Expect = 2e-06 Identities = 34/61 (55%), Positives = 36/61 (59%), Gaps = 8/61 (13%) Frame = -2 Query: 396 ASAFFASLERFSCINLSTTDVEDEEEARDRPLMLTN--------PVVQDGPETNDVNKLP 241 A AFFASLER SCINLST+D D+ EA DRPLM TN D NDV LP Sbjct: 20 AQAFFASLERCSCINLSTSDDADDSEAHDRPLMFTNCSSICSSVTSRTDNLPPNDVVNLP 79 Query: 240 V 238 V Sbjct: 80 V 80 >gb|EYU32268.1| hypothetical protein MIMGU_mgv1a017083mg [Mimulus guttatus] Length = 94 Score = 57.0 bits (136), Expect = 3e-06 Identities = 33/55 (60%), Positives = 37/55 (67%), Gaps = 3/55 (5%) Frame = -2 Query: 396 ASAFFASLERFSCINLSTTDVEDEEEARDRPLMLTN-PVVQDG--PETNDVNKLP 241 A+AFFASLER SCIN+STTD + +EEA DRPLMLT P P T KLP Sbjct: 32 ATAFFASLERCSCINISTTDSDVDEEANDRPLMLTKFPSFASSYHPSTPTAAKLP 86 >ref|XP_006444809.1| hypothetical protein CICLE_v10022804mg [Citrus clementina] gi|557547071|gb|ESR58049.1| hypothetical protein CICLE_v10022804mg [Citrus clementina] Length = 135 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = -2 Query: 396 ASAFFASLERFSCINLSTTDVEDEEEARDRPLMLTNPVV 280 A+AFFASLER SCINLST + EDE+EA+DRPLM+ V Sbjct: 75 ATAFFASLERCSCINLSTAEFEDEDEAKDRPLMVFRSTV 113 >gb|ABK23823.1| unknown [Picea sitchensis] Length = 122 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -2 Query: 393 SAFFASLERFSCINLSTTDVEDEEEARDRPLM 298 SAFFASLER SCI LS TD EDEEEA+DRPLM Sbjct: 54 SAFFASLERCSCITLSNTDTEDEEEAKDRPLM 85 >gb|EYU25255.1| hypothetical protein MIMGU_mgv1a015858mg [Mimulus guttatus] Length = 143 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/37 (75%), Positives = 33/37 (89%), Gaps = 1/37 (2%) Frame = -2 Query: 396 ASAFFASLERFSCINLSTTDVE-DEEEARDRPLMLTN 289 ASAFFASLER SC+NL+T D E D+EEA+DRPLMLT+ Sbjct: 74 ASAFFASLERCSCVNLTTFDTEDDDEEAKDRPLMLTS 110 >ref|XP_004145950.1| PREDICTED: uncharacterized protein LOC101207351 [Cucumis sativus] Length = 124 Score = 56.2 bits (134), Expect = 5e-06 Identities = 36/62 (58%), Positives = 41/62 (66%), Gaps = 9/62 (14%) Frame = -2 Query: 396 ASAFFASLERFSCINLSTT-DVEDEEEARDRPLM----LTNPVVQD----GPETNDVNKL 244 ASAFFASLER SCINLST+ D ED EEA DRPLM ++ V++ P NDV L Sbjct: 63 ASAFFASLERCSCINLSTSDDHEDPEEAHDRPLMYCTSTSSSVIRSFEPLPPPVNDVANL 122 Query: 243 PV 238 PV Sbjct: 123 PV 124 >gb|AEW09087.1| hypothetical protein CL3702Contig1_01, partial [Pinus radiata] gi|383141707|gb|AFG52213.1| hypothetical protein CL3702Contig1_01, partial [Pinus taeda] gi|383141709|gb|AFG52214.1| hypothetical protein CL3702Contig1_01, partial [Pinus taeda] gi|383141711|gb|AFG52215.1| hypothetical protein CL3702Contig1_01, partial [Pinus taeda] gi|383141713|gb|AFG52216.1| hypothetical protein CL3702Contig1_01, partial [Pinus taeda] gi|383141715|gb|AFG52217.1| hypothetical protein CL3702Contig1_01, partial [Pinus taeda] gi|383141717|gb|AFG52218.1| hypothetical protein CL3702Contig1_01, partial [Pinus taeda] gi|383141719|gb|AFG52219.1| hypothetical protein CL3702Contig1_01, partial [Pinus taeda] gi|383141721|gb|AFG52220.1| hypothetical protein CL3702Contig1_01, partial [Pinus taeda] gi|383141723|gb|AFG52221.1| hypothetical protein CL3702Contig1_01, partial [Pinus taeda] gi|383141725|gb|AFG52222.1| hypothetical protein CL3702Contig1_01, partial [Pinus taeda] gi|383141727|gb|AFG52223.1| hypothetical protein CL3702Contig1_01, partial [Pinus taeda] gi|383141729|gb|AFG52224.1| hypothetical protein CL3702Contig1_01, partial [Pinus taeda] gi|383141731|gb|AFG52225.1| hypothetical protein CL3702Contig1_01, partial [Pinus taeda] gi|383141733|gb|AFG52226.1| hypothetical protein CL3702Contig1_01, partial [Pinus taeda] gi|383141735|gb|AFG52227.1| hypothetical protein CL3702Contig1_01, partial [Pinus taeda] gi|383141737|gb|AFG52228.1| hypothetical protein CL3702Contig1_01, partial [Pinus taeda] gi|383141739|gb|AFG52229.1| hypothetical protein CL3702Contig1_01, partial [Pinus taeda] gi|383141741|gb|AFG52230.1| hypothetical protein CL3702Contig1_01, partial [Pinus taeda] Length = 95 Score = 56.2 bits (134), Expect = 5e-06 Identities = 30/52 (57%), Positives = 37/52 (71%), Gaps = 2/52 (3%) Frame = -2 Query: 396 ASAFFASLERFSCINLSTTDVEDEEEARDRPL--MLTNPVVQDGPETNDVNK 247 ASAFFASLER SCINLST D ED+EE +D PL + + V ++ E + VNK Sbjct: 34 ASAFFASLERCSCINLSTNDTEDDEEGKDMPLIPIKADHVEEEAIEKHKVNK 85 >ref|XP_002518873.1| conserved hypothetical protein [Ricinus communis] gi|223541860|gb|EEF43406.1| conserved hypothetical protein [Ricinus communis] Length = 95 Score = 55.8 bits (133), Expect = 6e-06 Identities = 30/59 (50%), Positives = 43/59 (72%), Gaps = 3/59 (5%) Frame = -2 Query: 393 SAFFASLERFSCINLSTTDVED---EEEARDRPLMLTNPVVQDGPETNDVNKLPV*SIG 226 SAFF+SLERFSC+N++T D +D EEEA+DRPL L++ + ++D++ LPV IG Sbjct: 32 SAFFSSLERFSCVNIATNDPDDDDNEEEAKDRPLALSS----NPHRSDDISDLPVFIIG 86