BLASTX nr result
ID: Akebia25_contig00010136
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00010136 (568 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007135855.1| hypothetical protein PHAVU_010G163700g [Phas... 103 4e-20 gb|AFK37028.1| unknown [Lotus japonicus] 103 4e-20 ref|NP_001276192.1| uncharacterized protein LOC102659420 [Glycin... 103 4e-20 ref|XP_006584149.1| PREDICTED: 7-dehydrocholesterol reductase-li... 102 9e-20 ref|XP_002316435.1| putative delta-7-sterol reductase family pro... 102 9e-20 gb|ABK93973.1| unknown [Populus trichocarpa] 102 9e-20 ref|XP_006393153.1| hypothetical protein EUTSA_v10011498mg [Eutr... 101 1e-19 ref|XP_007217217.1| hypothetical protein PRUPE_ppa004839mg [Prun... 100 3e-19 ref|XP_004141748.1| PREDICTED: 7-dehydrocholesterol reductase-li... 100 3e-19 ref|XP_006465140.1| PREDICTED: 7-dehydrocholesterol reductase-li... 100 3e-19 ref|XP_006436353.1| hypothetical protein CICLE_v100316311mg, par... 100 3e-19 gb|ABA01480.1| sterol delta-7 reductase DWF5 [Gossypium hirsutum] 100 3e-19 ref|XP_006307567.1| hypothetical protein CARUB_v10009190mg [Caps... 99 6e-19 ref|XP_002894252.1| hypothetical protein ARALYDRAFT_474170 [Arab... 99 6e-19 gb|EXB37443.1| 7-dehydrocholesterol reductase [Morus notabilis] 99 8e-19 ref|XP_007023691.1| Ergosterol biosynthesis ERG4/ERG24 family is... 99 8e-19 ref|XP_007023690.1| Ergosterol biosynthesis ERG4/ERG24 family is... 99 8e-19 gb|AAR29980.1| sterol delta-7 reductase [Tropaeolum majus] 99 8e-19 gb|EYU21205.1| hypothetical protein MIMGU_mgv1a006687mg [Mimulus... 99 1e-18 ref|NP_175460.1| 7-dehydrocholesterol reductase [Arabidopsis tha... 99 1e-18 >ref|XP_007135855.1| hypothetical protein PHAVU_010G163700g [Phaseolus vulgaris] gi|561008900|gb|ESW07849.1| hypothetical protein PHAVU_010G163700g [Phaseolus vulgaris] Length = 444 Score = 103 bits (256), Expect = 4e-20 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 566 PYFYVVFLTILLFDRAKRDDDRCRSKYGKYWKLYCDKVSYRIVPGIY 426 PYFYV+FLTILLFDRAKRDDDRCRSKYGKYWKLYCDKV YRI+PGIY Sbjct: 398 PYFYVIFLTILLFDRAKRDDDRCRSKYGKYWKLYCDKVPYRIIPGIY 444 >gb|AFK37028.1| unknown [Lotus japonicus] Length = 206 Score = 103 bits (256), Expect = 4e-20 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 566 PYFYVVFLTILLFDRAKRDDDRCRSKYGKYWKLYCDKVSYRIVPGIY 426 PYFYV+FLTILLFDRAKRDDDRCRSKYGKYWKLYCDKV YRI+PGIY Sbjct: 160 PYFYVIFLTILLFDRAKRDDDRCRSKYGKYWKLYCDKVPYRIIPGIY 206 >ref|NP_001276192.1| uncharacterized protein LOC102659420 [Glycine max] gi|255644667|gb|ACU22836.1| unknown [Glycine max] Length = 432 Score = 103 bits (256), Expect = 4e-20 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 566 PYFYVVFLTILLFDRAKRDDDRCRSKYGKYWKLYCDKVSYRIVPGIY 426 PYFYV+FLTILLFDRAKRDDDRCRSKYGKYWKLYCDKV YRI+PGIY Sbjct: 386 PYFYVIFLTILLFDRAKRDDDRCRSKYGKYWKLYCDKVPYRIIPGIY 432 >ref|XP_006584149.1| PREDICTED: 7-dehydrocholesterol reductase-like [Glycine max] Length = 120 Score = 102 bits (253), Expect = 9e-20 Identities = 43/47 (91%), Positives = 47/47 (100%) Frame = -3 Query: 566 PYFYVVFLTILLFDRAKRDDDRCRSKYGKYWKLYCDKVSYRIVPGIY 426 PYFYV+FLTILLFDRAKRDDDRCRSK+GKYWKLYCDKV+YRI+PGIY Sbjct: 74 PYFYVIFLTILLFDRAKRDDDRCRSKHGKYWKLYCDKVAYRIIPGIY 120 >ref|XP_002316435.1| putative delta-7-sterol reductase family protein [Populus trichocarpa] gi|222865475|gb|EEF02606.1| putative delta-7-sterol reductase family protein [Populus trichocarpa] Length = 434 Score = 102 bits (253), Expect = 9e-20 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 566 PYFYVVFLTILLFDRAKRDDDRCRSKYGKYWKLYCDKVSYRIVPGIY 426 PYFYV+FLTILLFDRAKRDDDRCRSKYGKYWKLYC+KV YRIVPGIY Sbjct: 388 PYFYVIFLTILLFDRAKRDDDRCRSKYGKYWKLYCEKVRYRIVPGIY 434 >gb|ABK93973.1| unknown [Populus trichocarpa] Length = 400 Score = 102 bits (253), Expect = 9e-20 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 566 PYFYVVFLTILLFDRAKRDDDRCRSKYGKYWKLYCDKVSYRIVPGIY 426 PYFYV+FLTILLFDRAKRDDDRCRSKYGKYWKLYC+KV YRIVPGIY Sbjct: 354 PYFYVIFLTILLFDRAKRDDDRCRSKYGKYWKLYCEKVRYRIVPGIY 400 >ref|XP_006393153.1| hypothetical protein EUTSA_v10011498mg [Eutrema salsugineum] gi|557089731|gb|ESQ30439.1| hypothetical protein EUTSA_v10011498mg [Eutrema salsugineum] Length = 432 Score = 101 bits (252), Expect = 1e-19 Identities = 43/47 (91%), Positives = 46/47 (97%) Frame = -3 Query: 566 PYFYVVFLTILLFDRAKRDDDRCRSKYGKYWKLYCDKVSYRIVPGIY 426 PYFYV+FLTILLFDRAKRDDDRCRSKYGKYWKLYC+KV YRI+PGIY Sbjct: 386 PYFYVIFLTILLFDRAKRDDDRCRSKYGKYWKLYCEKVRYRIIPGIY 432 >ref|XP_007217217.1| hypothetical protein PRUPE_ppa004839mg [Prunus persica] gi|462413367|gb|EMJ18416.1| hypothetical protein PRUPE_ppa004839mg [Prunus persica] Length = 489 Score = 100 bits (249), Expect = 3e-19 Identities = 43/47 (91%), Positives = 45/47 (95%) Frame = -3 Query: 566 PYFYVVFLTILLFDRAKRDDDRCRSKYGKYWKLYCDKVSYRIVPGIY 426 PYFYVVFLTILL DRAKRDDDRCRSKYGKYWKLYC KVSYR++PGIY Sbjct: 443 PYFYVVFLTILLLDRAKRDDDRCRSKYGKYWKLYCQKVSYRVIPGIY 489 >ref|XP_004141748.1| PREDICTED: 7-dehydrocholesterol reductase-like [Cucumis sativus] Length = 435 Score = 100 bits (249), Expect = 3e-19 Identities = 42/47 (89%), Positives = 46/47 (97%) Frame = -3 Query: 566 PYFYVVFLTILLFDRAKRDDDRCRSKYGKYWKLYCDKVSYRIVPGIY 426 PYFYV+FLTILLFDRAKRDDDRCRSKYGKYWKLYC+KV Y+I+PGIY Sbjct: 389 PYFYVIFLTILLFDRAKRDDDRCRSKYGKYWKLYCEKVPYKIIPGIY 435 >ref|XP_006465140.1| PREDICTED: 7-dehydrocholesterol reductase-like [Citrus sinensis] Length = 437 Score = 100 bits (248), Expect = 3e-19 Identities = 42/47 (89%), Positives = 45/47 (95%) Frame = -3 Query: 566 PYFYVVFLTILLFDRAKRDDDRCRSKYGKYWKLYCDKVSYRIVPGIY 426 PYFYV+FLTILLFDRAKRDDDRCRSKYGKYWK+YC KV YRI+PGIY Sbjct: 391 PYFYVIFLTILLFDRAKRDDDRCRSKYGKYWKIYCQKVPYRIIPGIY 437 >ref|XP_006436353.1| hypothetical protein CICLE_v100316311mg, partial [Citrus clementina] gi|557538549|gb|ESR49593.1| hypothetical protein CICLE_v100316311mg, partial [Citrus clementina] Length = 76 Score = 100 bits (248), Expect = 3e-19 Identities = 42/47 (89%), Positives = 45/47 (95%) Frame = -3 Query: 566 PYFYVVFLTILLFDRAKRDDDRCRSKYGKYWKLYCDKVSYRIVPGIY 426 PYFYV+FLTILLFDRAKRDDDRCRSKYGKYWK+YC KV YRI+PGIY Sbjct: 30 PYFYVIFLTILLFDRAKRDDDRCRSKYGKYWKIYCQKVPYRIIPGIY 76 >gb|ABA01480.1| sterol delta-7 reductase DWF5 [Gossypium hirsutum] Length = 437 Score = 100 bits (248), Expect = 3e-19 Identities = 44/47 (93%), Positives = 45/47 (95%) Frame = -3 Query: 566 PYFYVVFLTILLFDRAKRDDDRCRSKYGKYWKLYCDKVSYRIVPGIY 426 PYFYVVFLTILLFDRAKRDDDRCRSKYGKYWKLYC KV Y+IVPGIY Sbjct: 391 PYFYVVFLTILLFDRAKRDDDRCRSKYGKYWKLYCTKVPYKIVPGIY 437 >ref|XP_006307567.1| hypothetical protein CARUB_v10009190mg [Capsella rubella] gi|482576278|gb|EOA40465.1| hypothetical protein CARUB_v10009190mg [Capsella rubella] Length = 432 Score = 99.4 bits (246), Expect = 6e-19 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = -3 Query: 563 YFYVVFLTILLFDRAKRDDDRCRSKYGKYWKLYCDKVSYRIVPGIY 426 YFYV+FLTILLFDRAKRDDDRCRSKYGKYWKLYC+KV YRI+PGIY Sbjct: 387 YFYVIFLTILLFDRAKRDDDRCRSKYGKYWKLYCEKVKYRIIPGIY 432 >ref|XP_002894252.1| hypothetical protein ARALYDRAFT_474170 [Arabidopsis lyrata subsp. lyrata] gi|297340094|gb|EFH70511.1| hypothetical protein ARALYDRAFT_474170 [Arabidopsis lyrata subsp. lyrata] Length = 432 Score = 99.4 bits (246), Expect = 6e-19 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = -3 Query: 563 YFYVVFLTILLFDRAKRDDDRCRSKYGKYWKLYCDKVSYRIVPGIY 426 YFYV+FLTILLFDRAKRDDDRCRSKYGKYWKLYC+KV YRI+PGIY Sbjct: 387 YFYVIFLTILLFDRAKRDDDRCRSKYGKYWKLYCEKVKYRIIPGIY 432 >gb|EXB37443.1| 7-dehydrocholesterol reductase [Morus notabilis] Length = 434 Score = 99.0 bits (245), Expect = 8e-19 Identities = 42/47 (89%), Positives = 45/47 (95%) Frame = -3 Query: 566 PYFYVVFLTILLFDRAKRDDDRCRSKYGKYWKLYCDKVSYRIVPGIY 426 PYFYVVFL ILLFDRAKRDDDRCRSKYGKYWKLYC+KV YRI+PG+Y Sbjct: 388 PYFYVVFLIILLFDRAKRDDDRCRSKYGKYWKLYCEKVPYRIIPGLY 434 >ref|XP_007023691.1| Ergosterol biosynthesis ERG4/ERG24 family isoform 2 [Theobroma cacao] gi|508779057|gb|EOY26313.1| Ergosterol biosynthesis ERG4/ERG24 family isoform 2 [Theobroma cacao] Length = 438 Score = 99.0 bits (245), Expect = 8e-19 Identities = 42/47 (89%), Positives = 46/47 (97%) Frame = -3 Query: 566 PYFYVVFLTILLFDRAKRDDDRCRSKYGKYWKLYCDKVSYRIVPGIY 426 PYFYVVFLTILLFDRAKRDDDRCRSKYGK+WKLYC+KV Y+I+PGIY Sbjct: 392 PYFYVVFLTILLFDRAKRDDDRCRSKYGKFWKLYCNKVPYKIIPGIY 438 >ref|XP_007023690.1| Ergosterol biosynthesis ERG4/ERG24 family isoform 1 [Theobroma cacao] gi|508779056|gb|EOY26312.1| Ergosterol biosynthesis ERG4/ERG24 family isoform 1 [Theobroma cacao] Length = 437 Score = 99.0 bits (245), Expect = 8e-19 Identities = 42/47 (89%), Positives = 46/47 (97%) Frame = -3 Query: 566 PYFYVVFLTILLFDRAKRDDDRCRSKYGKYWKLYCDKVSYRIVPGIY 426 PYFYVVFLTILLFDRAKRDDDRCRSKYGK+WKLYC+KV Y+I+PGIY Sbjct: 391 PYFYVVFLTILLFDRAKRDDDRCRSKYGKFWKLYCNKVPYKIIPGIY 437 >gb|AAR29980.1| sterol delta-7 reductase [Tropaeolum majus] Length = 435 Score = 99.0 bits (245), Expect = 8e-19 Identities = 42/47 (89%), Positives = 45/47 (95%) Frame = -3 Query: 566 PYFYVVFLTILLFDRAKRDDDRCRSKYGKYWKLYCDKVSYRIVPGIY 426 PYFYVVFLTILLFDRAKRDDDRCRSKYGKYWKLYC +V Y+I+PGIY Sbjct: 389 PYFYVVFLTILLFDRAKRDDDRCRSKYGKYWKLYCQRVPYKIIPGIY 435 >gb|EYU21205.1| hypothetical protein MIMGU_mgv1a006687mg [Mimulus guttatus] Length = 435 Score = 98.6 bits (244), Expect = 1e-18 Identities = 42/47 (89%), Positives = 45/47 (95%) Frame = -3 Query: 566 PYFYVVFLTILLFDRAKRDDDRCRSKYGKYWKLYCDKVSYRIVPGIY 426 PYFYVVFLTILL DRAKRDDDRC+SKYGKYWKLYC+KV YR+VPGIY Sbjct: 389 PYFYVVFLTILLLDRAKRDDDRCKSKYGKYWKLYCEKVPYRVVPGIY 435 >ref|NP_175460.1| 7-dehydrocholesterol reductase [Arabidopsis thaliana] gi|20140296|sp|Q9LDU6.1|ST7R_ARATH RecName: Full=7-dehydrocholesterol reductase; Short=7-DHC reductase; AltName: Full=Protein DWARF 5; AltName: Full=Sterol Delta(7)-reductase gi|7542561|gb|AAF63498.1|AF239701_1 sterol delta7 reductase [Arabidopsis thaliana] gi|9454565|gb|AAF87888.1|AC012561_21 sterol delta7 reductase [Arabidopsis thaliana] gi|20466246|gb|AAM20440.1| sterol delta7 reductase [Arabidopsis thaliana] gi|23198074|gb|AAN15564.1| sterol delta7 reductase [Arabidopsis thaliana] gi|110742801|dbj|BAE99303.1| sterol delta7 reductase [Arabidopsis thaliana] gi|332194426|gb|AEE32547.1| 7-dehydrocholesterol reductase [Arabidopsis thaliana] Length = 432 Score = 98.6 bits (244), Expect = 1e-18 Identities = 41/46 (89%), Positives = 45/46 (97%) Frame = -3 Query: 563 YFYVVFLTILLFDRAKRDDDRCRSKYGKYWKLYCDKVSYRIVPGIY 426 YFYV+FLT+LLFDRAKRDDDRCRSKYGKYWKLYC+KV YRI+PGIY Sbjct: 387 YFYVIFLTLLLFDRAKRDDDRCRSKYGKYWKLYCEKVKYRIIPGIY 432