BLASTX nr result
ID: Akebia25_contig00009965
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00009965 (414 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB70684.1| hypothetical protein L484_023870 [Morus notabilis] 55 8e-06 >gb|EXB70684.1| hypothetical protein L484_023870 [Morus notabilis] Length = 85 Score = 55.5 bits (132), Expect = 8e-06 Identities = 30/55 (54%), Positives = 37/55 (67%) Frame = -1 Query: 414 SQSIPDNTLASELSTENLNSPNLDEVIDGGDAKKYRSKLISISYTQSPDTKILPV 250 S S+P+N L S+ S++ LN NL ID K+RS+LISISYTQSPD LPV Sbjct: 23 SYSLPENVLTSKPSSDKLNGENLVGGIDCDGEDKFRSELISISYTQSPDVGGLPV 77