BLASTX nr result
ID: Akebia25_contig00009604
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00009604 (319 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513573.1| Cyclic nucleotide-gated ion channel, putativ... 64 3e-08 ref|XP_007038982.1| Cyclic nucleotide gated channel 1 isoform 1 ... 63 4e-08 ref|XP_002322017.2| cyclic nucleotide-gated channel C family pro... 57 3e-06 ref|XP_002268992.1| PREDICTED: cyclic nucleotide-gated ion chann... 57 3e-06 >ref|XP_002513573.1| Cyclic nucleotide-gated ion channel, putative [Ricinus communis] gi|223547481|gb|EEF48976.1| Cyclic nucleotide-gated ion channel, putative [Ricinus communis] Length = 838 Score = 63.5 bits (153), Expect = 3e-08 Identities = 36/70 (51%), Positives = 46/70 (65%) Frame = +3 Query: 102 MNYREGKFVRFQTRNSEGSSSSKRQYSTRDGL*SGKLMNSISSFSERIQRSFEWGSKGIK 281 MNY + KFVRFQ SE S + QYS DG+ S K+ SI+S SE+ QR E GS+ IK Sbjct: 1 MNYSQEKFVRFQDWRSE--KSMETQYSVSDGIHSRKIRMSITSVSEKFQRGLESGSERIK 58 Query: 282 SVRKSLRFHS 311 +RKSL+ +S Sbjct: 59 RIRKSLKSYS 68 >ref|XP_007038982.1| Cyclic nucleotide gated channel 1 isoform 1 [Theobroma cacao] gi|590673757|ref|XP_007038983.1| Cyclic nucleotide gated channel 1 isoform 1 [Theobroma cacao] gi|508776227|gb|EOY23483.1| Cyclic nucleotide gated channel 1 isoform 1 [Theobroma cacao] gi|508776228|gb|EOY23484.1| Cyclic nucleotide gated channel 1 isoform 1 [Theobroma cacao] Length = 713 Score = 63.2 bits (152), Expect = 4e-08 Identities = 37/72 (51%), Positives = 48/72 (66%) Frame = +3 Query: 102 MNYREGKFVRFQTRNSEGSSSSKRQYSTRDGL*SGKLMNSISSFSERIQRSFEWGSKGIK 281 M+Y KFVRFQ NSE S++ QYS G+ SG++ +I+SFSE+ QR E GS+ IK Sbjct: 1 MSYPPEKFVRFQDWNSE--KSTEAQYSDNKGINSGRVRFAINSFSEKFQRGVESGSERIK 58 Query: 282 SVRKSLRFHSPN 317 +RKSLR S N Sbjct: 59 GIRKSLRSCSFN 70 >ref|XP_002322017.2| cyclic nucleotide-gated channel C family protein [Populus trichocarpa] gi|550321788|gb|EEF06144.2| cyclic nucleotide-gated channel C family protein [Populus trichocarpa] Length = 705 Score = 57.0 bits (136), Expect = 3e-06 Identities = 31/72 (43%), Positives = 44/72 (61%) Frame = +3 Query: 102 MNYREGKFVRFQTRNSEGSSSSKRQYSTRDGL*SGKLMNSISSFSERIQRSFEWGSKGIK 281 MN + KFVRFQ SE ++ + YS +G+ GK+ +ISS SE++QR E GS + Sbjct: 1 MNQPQEKFVRFQDWKSEKTTEGR--YSASNGIYPGKIRTTISSVSEKVQRGLESGSASFR 58 Query: 282 SVRKSLRFHSPN 317 + KSL+ HS N Sbjct: 59 RISKSLKSHSFN 70 >ref|XP_002268992.1| PREDICTED: cyclic nucleotide-gated ion channel 1 [Vitis vinifera] gi|302143681|emb|CBI22542.3| unnamed protein product [Vitis vinifera] Length = 709 Score = 57.0 bits (136), Expect = 3e-06 Identities = 33/70 (47%), Positives = 45/70 (64%) Frame = +3 Query: 102 MNYREGKFVRFQTRNSEGSSSSKRQYSTRDGL*SGKLMNSISSFSERIQRSFEWGSKGIK 281 MNYR+ KFVRFQ +SE SS K +G+ SGK+ +I+S S + QR E GS+ I Sbjct: 1 MNYRQEKFVRFQDWSSERSSEGK--IPINNGVRSGKIRLAINSVSGKFQRGLECGSERIN 58 Query: 282 SVRKSLRFHS 311 S+R+SL+ S Sbjct: 59 SIRRSLKSFS 68