BLASTX nr result
ID: Akebia25_contig00009447
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00009447 (218 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002306567.1| serine/threonine protein kinase [Populus tri... 55 8e-06 >ref|XP_002306567.1| serine/threonine protein kinase [Populus trichocarpa] gi|222856016|gb|EEE93563.1| serine/threonine protein kinase [Populus trichocarpa] Length = 343 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/39 (69%), Positives = 33/39 (84%) Frame = +2 Query: 101 QRITISEIKSHKWFLKNLPIELMEEDVNFQSNDINDTSQ 217 +RITI EIK+H WFLKNLPIELME ++QSND+N+ SQ Sbjct: 252 KRITIPEIKNHPWFLKNLPIELMEGG-SWQSNDVNNPSQ 289