BLASTX nr result
ID: Akebia25_contig00009421
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00009421 (513 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006435427.1| hypothetical protein CICLE_v10003083mg [Citr... 56 6e-06 >ref|XP_006435427.1| hypothetical protein CICLE_v10003083mg [Citrus clementina] gi|557537549|gb|ESR48667.1| hypothetical protein CICLE_v10003083mg [Citrus clementina] Length = 48 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/48 (60%), Positives = 33/48 (68%) Frame = +2 Query: 71 MMFMRGEPLVAKLATLAKFVVFPGSMFAASIYSPQEDPNYNNNKNQTK 214 M MRGEPLVAKLA LAK+V+ PGSM AA IYSP P Y ++ K Sbjct: 1 MAIMRGEPLVAKLAALAKYVILPGSMAAALIYSP---PQYGSSTKSQK 45