BLASTX nr result
ID: Akebia25_contig00009232
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00009232 (290 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAF98466.1| cytochrome P450 [Coptis japonica var. dissecta] 57 3e-06 ref|XP_006407057.1| hypothetical protein EUTSA_v10020855mg [Eutr... 55 1e-05 >dbj|BAF98466.1| cytochrome P450 [Coptis japonica var. dissecta] Length = 518 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -1 Query: 290 FELSATYVHAPYPVITLQPQYGVQIILHKL 201 FELS+TYVHAPY VITLQPQ+G Q+ILHKL Sbjct: 489 FELSSTYVHAPYTVITLQPQHGAQLILHKL 518 >ref|XP_006407057.1| hypothetical protein EUTSA_v10020855mg [Eutrema salsugineum] gi|557108203|gb|ESQ48510.1| hypothetical protein EUTSA_v10020855mg [Eutrema salsugineum] Length = 404 Score = 55.1 bits (131), Expect = 1e-05 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -1 Query: 290 FELSATYVHAPYPVITLQPQYGVQIILHKL 201 FELS +YVHAPYPVIT+ PQ+G Q+ILHKL Sbjct: 375 FELSPSYVHAPYPVITIHPQFGAQLILHKL 404