BLASTX nr result
ID: Akebia25_contig00008761
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00008761 (592 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006857211.1| hypothetical protein AMTR_s00065p00199990 [A... 78 2e-12 >ref|XP_006857211.1| hypothetical protein AMTR_s00065p00199990 [Amborella trichopoda] gi|548861294|gb|ERN18678.1| hypothetical protein AMTR_s00065p00199990 [Amborella trichopoda] Length = 647 Score = 77.8 bits (190), Expect = 2e-12 Identities = 40/72 (55%), Positives = 53/72 (73%) Frame = -1 Query: 592 EENKILMETCDVINQKLRIREHEIQTIRRKASEELEECKNEIDYLDNYYADTIKQLTNNL 413 E +K L ETC+VI Q LRIRE EI+ IR++A+E+LEE K E+DYLD Y + I++LT +L Sbjct: 460 EHSKTLEETCNVIGQNLRIREQEIKIIRQRATEQLEESKEEMDYLDRIYEEKIRKLTEDL 519 Query: 412 EKDEMEGKETEK 377 EK E K+ EK Sbjct: 520 EKRE---KQLEK 528