BLASTX nr result
ID: Akebia25_contig00008652
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00008652 (207 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI27227.3| unnamed protein product [Vitis vinifera] 57 3e-06 ref|XP_004295516.1| PREDICTED: DNA polymerase eta-like [Fragaria... 56 5e-06 >emb|CBI27227.3| unnamed protein product [Vitis vinifera] Length = 773 Score = 56.6 bits (135), Expect = 3e-06 Identities = 32/68 (47%), Positives = 42/68 (61%) Frame = +3 Query: 3 GTSSILRFFHTHNPSGSSSEQIPDGLIRETAPLSLSGNESCSGLNQVGPQKGTLGDETRI 182 GT SI+++FH + S SS +Q D E A LS SG+ES GLN QK G+ETRI Sbjct: 441 GTCSIMKYFHGQDLSSSSLKQPQDRSTEEAASLSHSGSESYLGLNPRETQKQFPGEETRI 500 Query: 183 DSDRPSVD 206 + D P++D Sbjct: 501 NYDMPNLD 508 >ref|XP_004295516.1| PREDICTED: DNA polymerase eta-like [Fragaria vesca subsp. vesca] Length = 722 Score = 56.2 bits (134), Expect = 5e-06 Identities = 33/67 (49%), Positives = 43/67 (64%) Frame = +3 Query: 3 GTSSILRFFHTHNPSGSSSEQIPDGLIRETAPLSLSGNESCSGLNQVGPQKGTLGDETRI 182 GT+SI ++FH H PS SS++Q+ D I E+AP S SGNE+ S LN PQ +ETRI Sbjct: 442 GTASITKYFHGHQPS-SSTKQLHDNFIEESAPPSPSGNENYSELNVNKPQIELPCEETRI 500 Query: 183 DSDRPSV 203 PS+ Sbjct: 501 KYADPSL 507