BLASTX nr result
ID: Akebia25_contig00008414
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00008414 (382 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007051176.1| RNA helicase family protein isoform 2 [Theob... 55 8e-06 >ref|XP_007051176.1| RNA helicase family protein isoform 2 [Theobroma cacao] gi|508703437|gb|EOX95333.1| RNA helicase family protein isoform 2 [Theobroma cacao] Length = 555 Score = 55.5 bits (132), Expect = 8e-06 Identities = 30/42 (71%), Positives = 33/42 (78%) Frame = -1 Query: 175 KFLSADANSAVSQYSHIKQMVSSLLYASADLPWASSVITISF 50 + LS A +VSQYS +KQMVSS LYASADLPWASSVIT F Sbjct: 513 EILSVAAMLSVSQYSLMKQMVSSRLYASADLPWASSVITKFF 554