BLASTX nr result
ID: Akebia25_contig00008321
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00008321 (476 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEH41592.1| abscisic acid 8'-hydroxylase [Ipomoea nil] 59 9e-07 gb|EYU29121.1| hypothetical protein MIMGU_mgv1a005972mg [Mimulus... 57 2e-06 ref|XP_004244436.1| PREDICTED: abscisic acid 8'-hydroxylase 1-li... 57 2e-06 ref|NP_001275145.1| ABA 8'-hydroxylase CYP707A1 [Solanum tuberos... 57 2e-06 >gb|AEH41592.1| abscisic acid 8'-hydroxylase [Ipomoea nil] Length = 466 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -2 Query: 475 RWSMTGPQDRIQYAPFALPQNGLPIRLSLK 386 RWSM GPQ+ IQY PFALPQNGLPIRLSLK Sbjct: 429 RWSMVGPQNGIQYGPFALPQNGLPIRLSLK 458 >gb|EYU29121.1| hypothetical protein MIMGU_mgv1a005972mg [Mimulus guttatus] Length = 463 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -2 Query: 475 RWSMTGPQDRIQYAPFALPQNGLPIRLSLK 386 RWSM GPQ+ IQYAPFALPQNGLPI LSLK Sbjct: 433 RWSMMGPQNGIQYAPFALPQNGLPITLSLK 462 >ref|XP_004244436.1| PREDICTED: abscisic acid 8'-hydroxylase 1-like [Solanum lycopersicum] Length = 469 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -2 Query: 475 RWSMTGPQDRIQYAPFALPQNGLPIRLSLK 386 RWSM GPQ+ IQY PFALPQNGLPI+LSLK Sbjct: 436 RWSMVGPQNGIQYGPFALPQNGLPIKLSLK 465 >ref|NP_001275145.1| ABA 8'-hydroxylase CYP707A1 [Solanum tuberosum] gi|76803519|gb|ABA55732.1| ABA 8'-hydroxylase CYP707A1 [Solanum tuberosum] Length = 469 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -2 Query: 475 RWSMTGPQDRIQYAPFALPQNGLPIRLSLK 386 RWSM GPQ+ IQY PFALPQNGLPI+LSLK Sbjct: 436 RWSMVGPQNGIQYGPFALPQNGLPIKLSLK 465