BLASTX nr result
ID: Akebia25_contig00008005
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00008005 (1631 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006482837.1| PREDICTED: uncharacterized protein At1g04910... 67 3e-08 ref|XP_006482836.1| PREDICTED: uncharacterized protein At1g04910... 67 3e-08 ref|XP_006439058.1| hypothetical protein CICLE_v10031320mg [Citr... 67 3e-08 ref|XP_002298576.2| hypothetical protein POPTR_0001s23420g [Popu... 67 3e-08 ref|XP_002313473.2| hypothetical protein POPTR_0009s02760g [Popu... 67 3e-08 ref|XP_004513144.1| PREDICTED: uncharacterized protein At1g04910... 67 3e-08 ref|XP_004513143.1| PREDICTED: uncharacterized protein At1g04910... 67 3e-08 ref|XP_003599015.1| Growth regulator like protein [Medicago trun... 67 3e-08 ref|XP_002520639.1| conserved hypothetical protein [Ricinus comm... 67 3e-08 ref|XP_004506509.1| PREDICTED: uncharacterized protein At1g04910... 65 9e-08 ref|XP_004161417.1| PREDICTED: DUF246 domain-containing protein ... 64 2e-07 ref|XP_002266606.1| PREDICTED: DUF246 domain-containing protein ... 64 2e-07 ref|XP_007052598.1| O-fucosyltransferase family protein [Theobro... 64 2e-07 gb|EYU31341.1| hypothetical protein MIMGU_mgv1a006110mg [Mimulus... 64 3e-07 gb|EPS73933.1| hypothetical protein M569_00823, partial [Genlise... 64 3e-07 ref|XP_004306502.1| PREDICTED: uncharacterized protein At1g04910... 64 3e-07 ref|XP_007220633.1| hypothetical protein PRUPE_ppa003424mg [Prun... 64 3e-07 ref|XP_006850060.1| hypothetical protein AMTR_s00022p00204610 [A... 63 3e-07 ref|XP_006293918.1| hypothetical protein CARUB_v10022909mg [Caps... 63 4e-07 ref|NP_973688.1| O-fucosyltransferase family protein [Arabidopsi... 63 4e-07 >ref|XP_006482837.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 [Citrus sinensis] gi|568858605|ref|XP_006482838.1| PREDICTED: uncharacterized protein At1g04910-like isoform X3 [Citrus sinensis] Length = 552 Score = 66.6 bits (161), Expect = 3e-08 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -3 Query: 258 YMLQLNREGVLLLRGLDSRLSKDLPSDLQKLRCKV 154 Y+ +LNREGVLLLRGLDSRLSKDLPSDLQKLRCKV Sbjct: 263 YLRRLNREGVLLLRGLDSRLSKDLPSDLQKLRCKV 297 >ref|XP_006482836.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 [Citrus sinensis] Length = 562 Score = 66.6 bits (161), Expect = 3e-08 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -3 Query: 258 YMLQLNREGVLLLRGLDSRLSKDLPSDLQKLRCKV 154 Y+ +LNREGVLLLRGLDSRLSKDLPSDLQKLRCKV Sbjct: 273 YLRRLNREGVLLLRGLDSRLSKDLPSDLQKLRCKV 307 >ref|XP_006439058.1| hypothetical protein CICLE_v10031320mg [Citrus clementina] gi|557541254|gb|ESR52298.1| hypothetical protein CICLE_v10031320mg [Citrus clementina] Length = 498 Score = 66.6 bits (161), Expect = 3e-08 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -3 Query: 258 YMLQLNREGVLLLRGLDSRLSKDLPSDLQKLRCKV 154 Y+ +LNREGVLLLRGLDSRLSKDLPSDLQKLRCKV Sbjct: 273 YLRRLNREGVLLLRGLDSRLSKDLPSDLQKLRCKV 307 >ref|XP_002298576.2| hypothetical protein POPTR_0001s23420g [Populus trichocarpa] gi|550347986|gb|EEE83381.2| hypothetical protein POPTR_0001s23420g [Populus trichocarpa] Length = 590 Score = 66.6 bits (161), Expect = 3e-08 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -3 Query: 258 YMLQLNREGVLLLRGLDSRLSKDLPSDLQKLRCKV 154 Y+ +LNREGVLLLRGLDSRLSKDLPSDLQKLRCKV Sbjct: 298 YLKRLNREGVLLLRGLDSRLSKDLPSDLQKLRCKV 332 >ref|XP_002313473.2| hypothetical protein POPTR_0009s02760g [Populus trichocarpa] gi|550330905|gb|EEE87428.2| hypothetical protein POPTR_0009s02760g [Populus trichocarpa] Length = 588 Score = 66.6 bits (161), Expect = 3e-08 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -3 Query: 258 YMLQLNREGVLLLRGLDSRLSKDLPSDLQKLRCKV 154 Y+ +LNREGVLLLRGLDSRLSKDLPSDLQKLRCKV Sbjct: 297 YLKRLNREGVLLLRGLDSRLSKDLPSDLQKLRCKV 331 >ref|XP_004513144.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 [Cicer arietinum] Length = 548 Score = 66.6 bits (161), Expect = 3e-08 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -3 Query: 258 YMLQLNREGVLLLRGLDSRLSKDLPSDLQKLRCKV 154 Y+ +LNREGVLLLRGLDSRLSKDLPSDLQKLRCKV Sbjct: 258 YLKRLNREGVLLLRGLDSRLSKDLPSDLQKLRCKV 292 >ref|XP_004513143.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 [Cicer arietinum] Length = 564 Score = 66.6 bits (161), Expect = 3e-08 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -3 Query: 258 YMLQLNREGVLLLRGLDSRLSKDLPSDLQKLRCKV 154 Y+ +LNREGVLLLRGLDSRLSKDLPSDLQKLRCKV Sbjct: 274 YLKRLNREGVLLLRGLDSRLSKDLPSDLQKLRCKV 308 >ref|XP_003599015.1| Growth regulator like protein [Medicago truncatula] gi|355488063|gb|AES69266.1| Growth regulator like protein [Medicago truncatula] Length = 600 Score = 66.6 bits (161), Expect = 3e-08 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -3 Query: 258 YMLQLNREGVLLLRGLDSRLSKDLPSDLQKLRCKV 154 Y+ +LNREGVLLLRGLDSRLSKDLPSDLQKLRCKV Sbjct: 273 YLRRLNREGVLLLRGLDSRLSKDLPSDLQKLRCKV 307 >ref|XP_002520639.1| conserved hypothetical protein [Ricinus communis] gi|223540159|gb|EEF41735.1| conserved hypothetical protein [Ricinus communis] Length = 589 Score = 66.6 bits (161), Expect = 3e-08 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -3 Query: 258 YMLQLNREGVLLLRGLDSRLSKDLPSDLQKLRCKV 154 Y+ +LNREGVLLLRGLDSRLSKDLPSDLQKLRCKV Sbjct: 297 YLKRLNREGVLLLRGLDSRLSKDLPSDLQKLRCKV 331 >ref|XP_004506509.1| PREDICTED: uncharacterized protein At1g04910-like [Cicer arietinum] Length = 581 Score = 65.1 bits (157), Expect = 9e-08 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -3 Query: 258 YMLQLNREGVLLLRGLDSRLSKDLPSDLQKLRCKV 154 Y+ + NREGVLLLRGLDSRLSKDLPSDLQKLRCKV Sbjct: 290 YLRRFNREGVLLLRGLDSRLSKDLPSDLQKLRCKV 324 >ref|XP_004161417.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis sativus] Length = 572 Score = 64.3 bits (155), Expect = 2e-07 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -3 Query: 258 YMLQLNREGVLLLRGLDSRLSKDLPSDLQKLRCKV 154 Y+ +L REGVLLLRGLDSRLSKDLPSDLQKLRCKV Sbjct: 280 YLRKLRREGVLLLRGLDSRLSKDLPSDLQKLRCKV 314 >ref|XP_002266606.1| PREDICTED: DUF246 domain-containing protein At1g04910 [Vitis vinifera] gi|297736200|emb|CBI24838.3| unnamed protein product [Vitis vinifera] Length = 536 Score = 64.3 bits (155), Expect = 2e-07 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -3 Query: 258 YMLQLNREGVLLLRGLDSRLSKDLPSDLQKLRCKV 154 Y+ +L REGVLLLRGLDSRLSKDLPSDLQKLRCKV Sbjct: 243 YLKRLRREGVLLLRGLDSRLSKDLPSDLQKLRCKV 277 >ref|XP_007052598.1| O-fucosyltransferase family protein [Theobroma cacao] gi|508704859|gb|EOX96755.1| O-fucosyltransferase family protein [Theobroma cacao] Length = 551 Score = 63.9 bits (154), Expect = 2e-07 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -3 Query: 258 YMLQLNREGVLLLRGLDSRLSKDLPSDLQKLRCKV 154 Y+ ++NREGVLLLRGLDSRLSKDLP DLQKLRCKV Sbjct: 262 YLKRINREGVLLLRGLDSRLSKDLPPDLQKLRCKV 296 >gb|EYU31341.1| hypothetical protein MIMGU_mgv1a006110mg [Mimulus guttatus] Length = 457 Score = 63.5 bits (153), Expect = 3e-07 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -3 Query: 258 YMLQLNREGVLLLRGLDSRLSKDLPSDLQKLRCKV 154 Y+ ++ REGVLLLRGLDSRLSKDLPSDLQKLRCKV Sbjct: 165 YLKRIRREGVLLLRGLDSRLSKDLPSDLQKLRCKV 199 >gb|EPS73933.1| hypothetical protein M569_00823, partial [Genlisea aurea] Length = 366 Score = 63.5 bits (153), Expect = 3e-07 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -3 Query: 258 YMLQLNREGVLLLRGLDSRLSKDLPSDLQKLRCKV 154 Y+ ++ REGVLLLRGLDSRLSKDLPSDLQKLRCKV Sbjct: 237 YLKRIRREGVLLLRGLDSRLSKDLPSDLQKLRCKV 271 >ref|XP_004306502.1| PREDICTED: uncharacterized protein At1g04910-like [Fragaria vesca subsp. vesca] Length = 577 Score = 63.5 bits (153), Expect = 3e-07 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -3 Query: 258 YMLQLNREGVLLLRGLDSRLSKDLPSDLQKLRCKV 154 Y+ ++ REGVLLLRGLDSRLSKDLPSDLQKLRCKV Sbjct: 285 YLKRIKREGVLLLRGLDSRLSKDLPSDLQKLRCKV 319 >ref|XP_007220633.1| hypothetical protein PRUPE_ppa003424mg [Prunus persica] gi|462417095|gb|EMJ21832.1| hypothetical protein PRUPE_ppa003424mg [Prunus persica] Length = 575 Score = 63.5 bits (153), Expect = 3e-07 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -3 Query: 258 YMLQLNREGVLLLRGLDSRLSKDLPSDLQKLRCKV 154 Y+ ++ REGVLLLRGLDSRLSKDLPSDLQKLRCKV Sbjct: 283 YLKRIKREGVLLLRGLDSRLSKDLPSDLQKLRCKV 317 >ref|XP_006850060.1| hypothetical protein AMTR_s00022p00204610 [Amborella trichopoda] gi|548853658|gb|ERN11641.1| hypothetical protein AMTR_s00022p00204610 [Amborella trichopoda] Length = 539 Score = 63.2 bits (152), Expect = 3e-07 Identities = 29/35 (82%), Positives = 34/35 (97%) Frame = -3 Query: 258 YMLQLNREGVLLLRGLDSRLSKDLPSDLQKLRCKV 154 Y+ +LN+EG+LLLRGLDSRLSKDLPSDLQ+LRCKV Sbjct: 244 YLRRLNKEGLLLLRGLDSRLSKDLPSDLQRLRCKV 278 >ref|XP_006293918.1| hypothetical protein CARUB_v10022909mg [Capsella rubella] gi|482562626|gb|EOA26816.1| hypothetical protein CARUB_v10022909mg [Capsella rubella] Length = 567 Score = 62.8 bits (151), Expect = 4e-07 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -3 Query: 258 YMLQLNREGVLLLRGLDSRLSKDLPSDLQKLRCKV 154 Y+ ++NRE VLLLRGLDSRLSKDLPSDLQKLRCKV Sbjct: 275 YLKRINRERVLLLRGLDSRLSKDLPSDLQKLRCKV 309 >ref|NP_973688.1| O-fucosyltransferase family protein [Arabidopsis thaliana] gi|330255335|gb|AEC10429.1| O-fucosyltransferase family protein [Arabidopsis thaliana] Length = 422 Score = 62.8 bits (151), Expect = 4e-07 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -3 Query: 258 YMLQLNREGVLLLRGLDSRLSKDLPSDLQKLRCKV 154 Y+ ++NRE VLLLRGLDSRLSKDLPSDLQKLRCKV Sbjct: 278 YLKRINRERVLLLRGLDSRLSKDLPSDLQKLRCKV 312