BLASTX nr result
ID: Akebia25_contig00007395
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00007395 (437 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU36666.1| hypothetical protein MIMGU_mgv1a005632mg [Mimulus... 55 8e-06 >gb|EYU36666.1| hypothetical protein MIMGU_mgv1a005632mg [Mimulus guttatus] Length = 476 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -2 Query: 94 MDIAAQLKRGISRQFSTGSLRKSGKFIFTRQ 2 MD+A+QLKRGISRQFSTGSLRKSG+F F RQ Sbjct: 1 MDVASQLKRGISRQFSTGSLRKSGRFSFRRQ 31