BLASTX nr result
ID: Akebia25_contig00005751
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00005751 (252 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516582.1| DNA polymerase theta, putative [Ricinus comm... 60 2e-07 >ref|XP_002516582.1| DNA polymerase theta, putative [Ricinus communis] gi|223544402|gb|EEF45923.1| DNA polymerase theta, putative [Ricinus communis] Length = 2154 Score = 60.5 bits (145), Expect = 2e-07 Identities = 39/82 (47%), Positives = 47/82 (57%) Frame = +1 Query: 1 AKGTLDNYLVNSQDDNFRDHGVSLRQEPIKRNLALEINLSSGVVRKPDFSSIQERSQSIE 180 AKGTLDNYLVNSQD N G+ RQ+ +KRNLALEIN S + S + SQ+ E Sbjct: 44 AKGTLDNYLVNSQDQN---RGLLSRQDSVKRNLALEINELSKDEKMDPCSVAKLDSQNSE 100 Query: 181 GLNEGQKGTLRDSSGVNDVAAE 246 G +K T + S VA E Sbjct: 101 GAGTIKKETSQGSCNAGHVAVE 122