BLASTX nr result
ID: Akebia25_contig00004894
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00004894 (416 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC16177.1| hypothetical protein L484_024345 [Morus notabilis] 58 1e-06 >gb|EXC16177.1| hypothetical protein L484_024345 [Morus notabilis] Length = 646 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = -3 Query: 114 DNYASWSRAMMIALSVKNKLGLIDESIIKPE 22 DNYASWSRAMMIALSVKNKLG ID SI KPE Sbjct: 554 DNYASWSRAMMIALSVKNKLGFIDGSITKPE 584