BLASTX nr result
ID: Akebia25_contig00004546
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00004546 (262 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYE94885.1| hypothetical protein EURHEDRAFT_456629 [Aspergill... 57 4e-06 ref|XP_003189772.1| hypothetical protein AOR_1_1362144 [Aspergil... 55 8e-06 >gb|EYE94885.1| hypothetical protein EURHEDRAFT_456629 [Aspergillus ruber CBS 135680] Length = 90 Score = 56.6 bits (135), Expect = 4e-06 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = -3 Query: 161 DPEKWTTEELRTWLKNRNLLPSAGATREELLARVRDNIK 45 DPE WT +EL+ WL+ R LLPSA ATREELL RV+ N++ Sbjct: 45 DPEDWTADELKRWLRLRGLLPSARATREELLERVKANLR 83 >ref|XP_003189772.1| hypothetical protein AOR_1_1362144 [Aspergillus oryzae RIB40] Length = 90 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/39 (58%), Positives = 30/39 (76%) Frame = -3 Query: 161 DPEKWTTEELRTWLKNRNLLPSAGATREELLARVRDNIK 45 DPE WT EE++ WL NR L+P+ ATREELL RV+ N++ Sbjct: 45 DPETWTVEEMKRWLSNRGLMPNNEATREELLERVKANLR 83