BLASTX nr result
ID: Akebia25_contig00003272
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00003272 (526 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EJY66654.1| hypothetical protein OXYTRI_13059 [Oxytricha trif... 80 2e-13 gb|ENH98510.1| hypothetical protein COCC4DRAFT_155570 [Bipolaris... 69 7e-10 ref|XP_007371709.1| hypothetical protein DICSQDRAFT_73523, parti... 69 7e-10 gb|EGZ04885.1| hypothetical protein PHYSODRAFT_291676 [Phytophth... 69 7e-10 gb|EMC90815.1| hypothetical protein BAUCODRAFT_56811, partial [B... 67 3e-09 ref|XP_007335665.1| hypothetical protein AGABI1DRAFT_49393, part... 67 3e-09 gb|EGN91453.1| hypothetical protein SERLA73DRAFT_67379 [Serpula ... 67 3e-09 ref|XP_003614391.1| Tar1p [Medicago truncatula] gi|355515726|gb|... 67 3e-09 gb|ACU24256.1| unknown [Glycine max] 65 7e-09 ref|XP_007413083.1| hypothetical protein MELLADRAFT_90060 [Melam... 65 1e-08 ref|XP_007413993.1| hypothetical protein MELLADRAFT_90623 [Melam... 65 1e-08 ref|XP_007414633.1| hypothetical protein MELLADRAFT_91703 [Melam... 65 1e-08 ref|XP_007415543.1| hypothetical protein MELLADRAFT_92712 [Melam... 65 1e-08 ref|XP_007417431.1| hypothetical protein MELLADRAFT_94729 [Melam... 65 1e-08 ref|XP_007417435.1| hypothetical protein MELLADRAFT_94733 [Melam... 65 1e-08 ref|XP_007405674.1| hypothetical protein MELLADRAFT_92520 [Melam... 65 1e-08 ref|XP_007419024.1| hypothetical protein MELLADRAFT_84532 [Melam... 65 1e-08 gb|EGN91569.1| hypothetical protein SERLA73DRAFT_128133 [Serpula... 65 1e-08 ref|XP_001698950.1| hypothetical protein CHLREDRAFT_155068 [Chla... 65 1e-08 gb|EHK48568.1| hypothetical protein TRIATDRAFT_255346 [Trichoder... 64 2e-08 >gb|EJY66654.1| hypothetical protein OXYTRI_13059 [Oxytricha trifallax] Length = 111 Score = 80.5 bits (197), Expect = 2e-13 Identities = 42/73 (57%), Positives = 44/73 (60%), Gaps = 3/73 (4%) Frame = -1 Query: 526 ELFNCNNFNIRYWSWNYRGCWHQTCXXXXXXXXXXXXXXXIARPKRALHQYLLS--LPPR 353 ELFNCNNFNIRYWSWNYRGCWHQTC IA PK L + LP Sbjct: 22 ELFNCNNFNIRYWSWNYRGCWHQTC--PPIDPRKGVQILLIAIPKHRLRSVISCHYLPES 79 Query: 352 -IGNLRACCLPWM 317 +GNLRACCLP M Sbjct: 80 GLGNLRACCLPQM 92 >gb|ENH98510.1| hypothetical protein COCC4DRAFT_155570 [Bipolaris maydis ATCC 48331] gi|576911966|gb|EUC26718.1| hypothetical protein COCCADRAFT_42279 [Bipolaris zeicola 26-R-13] Length = 68 Score = 68.9 bits (167), Expect = 7e-10 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 526 ELFNCNNFNIRYWSWNYRGCWHQTC 452 ELFNCNNFNIRYWSWNYRGCWHQTC Sbjct: 38 ELFNCNNFNIRYWSWNYRGCWHQTC 62 >ref|XP_007371709.1| hypothetical protein DICSQDRAFT_73523, partial [Dichomitus squalens LYAD-421 SS1] gi|395323025|gb|EJF55554.1| hypothetical protein DICSQDRAFT_73523, partial [Dichomitus squalens LYAD-421 SS1] Length = 66 Score = 68.9 bits (167), Expect = 7e-10 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 526 ELFNCNNFNIRYWSWNYRGCWHQTC 452 ELFNCNNFNIRYWSWNYRGCWHQTC Sbjct: 36 ELFNCNNFNIRYWSWNYRGCWHQTC 60 >gb|EGZ04885.1| hypothetical protein PHYSODRAFT_291676 [Phytophthora sojae] gi|348671639|gb|EGZ11460.1| hypothetical protein PHYSODRAFT_287468 [Phytophthora sojae] Length = 55 Score = 68.9 bits (167), Expect = 7e-10 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -1 Query: 526 ELFNCNNFNIRYWSWNYRGCWHQTC 452 ELFNCNNFNIRYWSWNYRGCWHQTC Sbjct: 25 ELFNCNNFNIRYWSWNYRGCWHQTC 49 >gb|EMC90815.1| hypothetical protein BAUCODRAFT_56811, partial [Baudoinia compniacensis UAMH 10762] Length = 51 Score = 67.0 bits (162), Expect = 3e-09 Identities = 37/61 (60%), Positives = 38/61 (62%) Frame = +2 Query: 278 GSTPER*PE*RLTHPRKAAGAQITDTGR**Q*ILMQGSFGSCNWNEYNLNPLTRNNWRAS 457 GSTPER PE RL HPRKAAGAQIT + EYNLNPLTRNNWRAS Sbjct: 1 GSTPEREPEKRLPHPRKAAGAQITQS----------------RHGEYNLNPLTRNNWRAS 44 Query: 458 L 460 L Sbjct: 45 L 45 >ref|XP_007335665.1| hypothetical protein AGABI1DRAFT_49393, partial [Agaricus bisporus var. burnettii JB137-S8] gi|409072524|gb|EKM73697.1| hypothetical protein AGABI1DRAFT_49393, partial [Agaricus bisporus var. burnettii JB137-S8] Length = 73 Score = 67.0 bits (162), Expect = 3e-09 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -1 Query: 523 LFNCNNFNIRYWSWNYRGCWHQTC 452 LFNCNNFNIRYWSWNYRGCWHQTC Sbjct: 44 LFNCNNFNIRYWSWNYRGCWHQTC 67 >gb|EGN91453.1| hypothetical protein SERLA73DRAFT_67379 [Serpula lacrymans var. lacrymans S7.3] Length = 80 Score = 67.0 bits (162), Expect = 3e-09 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = -1 Query: 526 ELFNCNNFNIRYWSWNYRGCWHQTC 452 ELFNCNNFNI YWSWNYRGCWHQTC Sbjct: 50 ELFNCNNFNIHYWSWNYRGCWHQTC 74 >ref|XP_003614391.1| Tar1p [Medicago truncatula] gi|355515726|gb|AES97349.1| Tar1p [Medicago truncatula] Length = 553 Score = 66.6 bits (161), Expect = 3e-09 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = -1 Query: 526 ELFNCNNFNIRYWSWNYRGCWHQTC 452 ELFNCNN NIRYWSWNYRGCWHQTC Sbjct: 523 ELFNCNNLNIRYWSWNYRGCWHQTC 547 >gb|ACU24256.1| unknown [Glycine max] Length = 75 Score = 65.5 bits (158), Expect = 7e-09 Identities = 34/59 (57%), Positives = 39/59 (66%), Gaps = 2/59 (3%) Frame = -2 Query: 447 QLFLVKGFKLYSFQLQDPKEPCISIYCHYLPVS--VICAPAAFLGCVSRYSGYLSGVDP 277 Q LVKGF+LYSFQL D P + P VICAPAAFLGC SR+SG LSG++P Sbjct: 17 QWILVKGFRLYSFQLPDSMSPVLLFIVTTSPCQDWVICAPAAFLGCGSRFSGSLSGIEP 75 >ref|XP_007413083.1| hypothetical protein MELLADRAFT_90060 [Melampsora larici-populina 98AG31] gi|328854504|gb|EGG03636.1| hypothetical protein MELLADRAFT_90060 [Melampsora larici-populina 98AG31] Length = 87 Score = 65.1 bits (157), Expect = 1e-08 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = -1 Query: 526 ELFNCNNFNIRYWSWNYRGCWHQTC 452 ELFN NNFNIRYWSWNYRGCWHQTC Sbjct: 25 ELFNVNNFNIRYWSWNYRGCWHQTC 49 >ref|XP_007413993.1| hypothetical protein MELLADRAFT_90623 [Melampsora larici-populina 98AG31] gi|328853743|gb|EGG02880.1| hypothetical protein MELLADRAFT_90623 [Melampsora larici-populina 98AG31] Length = 134 Score = 65.1 bits (157), Expect = 1e-08 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = -1 Query: 526 ELFNCNNFNIRYWSWNYRGCWHQTC 452 ELFN NNFNIRYWSWNYRGCWHQTC Sbjct: 72 ELFNVNNFNIRYWSWNYRGCWHQTC 96 >ref|XP_007414633.1| hypothetical protein MELLADRAFT_91703 [Melampsora larici-populina 98AG31] gi|328852954|gb|EGG02096.1| hypothetical protein MELLADRAFT_91703 [Melampsora larici-populina 98AG31] Length = 71 Score = 65.1 bits (157), Expect = 1e-08 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = -1 Query: 526 ELFNCNNFNIRYWSWNYRGCWHQTC 452 ELFN NNFNIRYWSWNYRGCWHQTC Sbjct: 41 ELFNVNNFNIRYWSWNYRGCWHQTC 65 >ref|XP_007415543.1| hypothetical protein MELLADRAFT_92712 [Melampsora larici-populina 98AG31] gi|328852044|gb|EGG01193.1| hypothetical protein MELLADRAFT_92712 [Melampsora larici-populina 98AG31] Length = 130 Score = 65.1 bits (157), Expect = 1e-08 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = -1 Query: 526 ELFNCNNFNIRYWSWNYRGCWHQTC 452 ELFN NNFNIRYWSWNYRGCWHQTC Sbjct: 68 ELFNVNNFNIRYWSWNYRGCWHQTC 92 >ref|XP_007417431.1| hypothetical protein MELLADRAFT_94729 [Melampsora larici-populina 98AG31] gi|328850152|gb|EGF99321.1| hypothetical protein MELLADRAFT_94729 [Melampsora larici-populina 98AG31] Length = 113 Score = 65.1 bits (157), Expect = 1e-08 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = -1 Query: 526 ELFNCNNFNIRYWSWNYRGCWHQTC 452 ELFN NNFNIRYWSWNYRGCWHQTC Sbjct: 51 ELFNVNNFNIRYWSWNYRGCWHQTC 75 >ref|XP_007417435.1| hypothetical protein MELLADRAFT_94733 [Melampsora larici-populina 98AG31] gi|328850149|gb|EGF99318.1| hypothetical protein MELLADRAFT_94733 [Melampsora larici-populina 98AG31] Length = 106 Score = 65.1 bits (157), Expect = 1e-08 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = -1 Query: 526 ELFNCNNFNIRYWSWNYRGCWHQTC 452 ELFN NNFNIRYWSWNYRGCWHQTC Sbjct: 44 ELFNVNNFNIRYWSWNYRGCWHQTC 68 >ref|XP_007405674.1| hypothetical protein MELLADRAFT_92520 [Melampsora larici-populina 98AG31] gi|599406978|ref|XP_007413435.1| hypothetical protein MELLADRAFT_90342 [Melampsora larici-populina 98AG31] gi|599420165|ref|XP_007416289.1| hypothetical protein MELLADRAFT_93286 [Melampsora larici-populina 98AG31] gi|599426092|ref|XP_007417784.1| hypothetical protein MELLADRAFT_95029 [Melampsora larici-populina 98AG31] gi|328849783|gb|EGF98957.1| hypothetical protein MELLADRAFT_95029 [Melampsora larici-populina 98AG31] gi|328851287|gb|EGG00443.1| hypothetical protein MELLADRAFT_93286 [Melampsora larici-populina 98AG31] gi|328854166|gb|EGG03300.1| hypothetical protein MELLADRAFT_90342 [Melampsora larici-populina 98AG31] gi|328861970|gb|EGG11072.1| hypothetical protein MELLADRAFT_92520 [Melampsora larici-populina 98AG31] Length = 103 Score = 65.1 bits (157), Expect = 1e-08 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = -1 Query: 526 ELFNCNNFNIRYWSWNYRGCWHQTC 452 ELFN NNFNIRYWSWNYRGCWHQTC Sbjct: 41 ELFNVNNFNIRYWSWNYRGCWHQTC 65 >ref|XP_007419024.1| hypothetical protein MELLADRAFT_84532 [Melampsora larici-populina 98AG31] gi|328848488|gb|EGF97701.1| hypothetical protein MELLADRAFT_84532 [Melampsora larici-populina 98AG31] Length = 146 Score = 65.1 bits (157), Expect = 1e-08 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = -1 Query: 526 ELFNCNNFNIRYWSWNYRGCWHQTC 452 ELFN NNFNIRYWSWNYRGCWHQTC Sbjct: 84 ELFNVNNFNIRYWSWNYRGCWHQTC 108 >gb|EGN91569.1| hypothetical protein SERLA73DRAFT_128133 [Serpula lacrymans var. lacrymans S7.3] Length = 114 Score = 64.7 bits (156), Expect = 1e-08 Identities = 49/94 (52%), Positives = 56/94 (59%) Frame = +2 Query: 179 MALSRRWFIQISALST*LVSSVHQWFRRVTGV*GSTPER*PE*RLTHPRKAAGAQITDTG 358 MAL RR FIQISALST + R+ G E PE RL HPRKAAGAQIT + Sbjct: 1 MALCRRCFIQISALST--------FDGRIEAYHGFNGE--PEKRLPHPRKAAGAQITQS- 49 Query: 359 R**Q*ILMQGSFGSCNWNEYNLNPLTRNNWRASL 460 R + + + + G W YNLN LTRNNWRASL Sbjct: 50 RYGEVVTINNNIG-LFW--YNLNLLTRNNWRASL 80 >ref|XP_001698950.1| hypothetical protein CHLREDRAFT_155068 [Chlamydomonas reinhardtii] gi|158269841|gb|EDO95983.1| predicted protein [Chlamydomonas reinhardtii] Length = 87 Score = 64.7 bits (156), Expect = 1e-08 Identities = 23/24 (95%), Positives = 23/24 (95%) Frame = -1 Query: 523 LFNCNNFNIRYWSWNYRGCWHQTC 452 LFNCNN NIRYWSWNYRGCWHQTC Sbjct: 58 LFNCNNLNIRYWSWNYRGCWHQTC 81 >gb|EHK48568.1| hypothetical protein TRIATDRAFT_255346 [Trichoderma atroviride IMI 206040] Length = 59 Score = 64.3 bits (155), Expect = 2e-08 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = -1 Query: 526 ELFNCNNFNIRYWSWNYRGCWHQTC 452 ELFN NNFNIRYWSWNYRGCWHQTC Sbjct: 29 ELFNHNNFNIRYWSWNYRGCWHQTC 53