BLASTX nr result
ID: Akebia25_contig00002797
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00002797 (571 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006453249.1| hypothetical protein CICLE_v10010500mg, part... 77 4e-12 ref|XP_006474270.1| PREDICTED: mitotic-spindle organizing protei... 74 2e-11 ref|XP_003516891.1| PREDICTED: mitotic-spindle organizing protei... 74 3e-11 ref|XP_003520913.1| PREDICTED: mitotic-spindle organizing protei... 74 3e-11 ref|XP_002532107.1| conserved hypothetical protein [Ricinus comm... 73 6e-11 ref|XP_007162066.1| hypothetical protein PHAVU_001G120800g [Phas... 72 1e-10 ref|XP_007036711.1| AtGCP3 interacting protein 1 [Theobroma caca... 72 1e-10 gb|AFK42464.1| unknown [Lotus japonicus] 72 1e-10 gb|AFK35562.1| unknown [Medicago truncatula] 71 2e-10 ref|XP_003609888.1| hypothetical protein MTR_4g124060 [Medicago ... 71 2e-10 emb|CBI32803.3| unnamed protein product [Vitis vinifera] 70 5e-10 ref|XP_004492490.1| PREDICTED: mitotic-spindle organizing protei... 69 7e-10 ref|XP_002283004.1| PREDICTED: mitotic-spindle organizing protei... 69 7e-10 ref|XP_002323237.1| hypothetical protein POPTR_0016s03370g [Popu... 69 9e-10 ref|XP_002308877.1| hypothetical protein POPTR_0006s03430g [Popu... 69 1e-09 ref|XP_006347344.1| PREDICTED: mitotic-spindle organizing protei... 68 2e-09 ref|XP_004241447.1| PREDICTED: mitotic-spindle organizing protei... 68 2e-09 ref|XP_004138897.1| PREDICTED: mitotic-spindle organizing protei... 68 2e-09 ref|XP_002270835.1| PREDICTED: mitotic-spindle organizing protei... 68 2e-09 ref|XP_004235364.1| PREDICTED: mitotic-spindle organizing protei... 67 3e-09 >ref|XP_006453249.1| hypothetical protein CICLE_v10010500mg, partial [Citrus clementina] gi|557556475|gb|ESR66489.1| hypothetical protein CICLE_v10010500mg, partial [Citrus clementina] Length = 141 Score = 76.6 bits (187), Expect = 4e-12 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -1 Query: 484 DMDPESSRTARESLDLAFHMSNILDTGLDRHTLSILIAL 368 DMDPE++RTARESLDLAFHMSNILDTGLDRHTLSILIAL Sbjct: 68 DMDPEAARTARESLDLAFHMSNILDTGLDRHTLSILIAL 106 >ref|XP_006474270.1| PREDICTED: mitotic-spindle organizing protein 1B-like isoform X1 [Citrus sinensis] gi|568840635|ref|XP_006474271.1| PREDICTED: mitotic-spindle organizing protein 1B-like isoform X2 [Citrus sinensis] Length = 73 Score = 74.3 bits (181), Expect = 2e-11 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = -1 Query: 481 MDPESSRTARESLDLAFHMSNILDTGLDRHTLSILIAL 368 MDPE++RTARESLDLAFHMSNILDTGLDRHTLSILIAL Sbjct: 1 MDPEAARTARESLDLAFHMSNILDTGLDRHTLSILIAL 38 >ref|XP_003516891.1| PREDICTED: mitotic-spindle organizing protein 1B-like isoform X1 [Glycine max] gi|571434840|ref|XP_006573311.1| PREDICTED: mitotic-spindle organizing protein 1B-like isoform X2 [Glycine max] Length = 74 Score = 73.9 bits (180), Expect = 3e-11 Identities = 35/38 (92%), Positives = 38/38 (100%) Frame = -1 Query: 481 MDPESSRTARESLDLAFHMSNILDTGLDRHTLSILIAL 368 MDPE++RTARESLDLAFHMSNILDTGLDRHTLS+LIAL Sbjct: 1 MDPEAARTARESLDLAFHMSNILDTGLDRHTLSVLIAL 38 >ref|XP_003520913.1| PREDICTED: mitotic-spindle organizing protein 1B [Glycine max] gi|255633504|gb|ACU17110.1| unknown [Glycine max] Length = 73 Score = 73.9 bits (180), Expect = 3e-11 Identities = 35/38 (92%), Positives = 38/38 (100%) Frame = -1 Query: 481 MDPESSRTARESLDLAFHMSNILDTGLDRHTLSILIAL 368 MDPE++RTARESLDLAFHMSNILDTGLDRHTLS+LIAL Sbjct: 1 MDPEAARTARESLDLAFHMSNILDTGLDRHTLSVLIAL 38 >ref|XP_002532107.1| conserved hypothetical protein [Ricinus communis] gi|223528210|gb|EEF30269.1| conserved hypothetical protein [Ricinus communis] Length = 74 Score = 72.8 bits (177), Expect = 6e-11 Identities = 34/38 (89%), Positives = 38/38 (100%) Frame = -1 Query: 481 MDPESSRTARESLDLAFHMSNILDTGLDRHTLSILIAL 368 MDPE+++TARESLDLAFHMSNILDTGLDRHTLS+LIAL Sbjct: 1 MDPEAAKTARESLDLAFHMSNILDTGLDRHTLSVLIAL 38 >ref|XP_007162066.1| hypothetical protein PHAVU_001G120800g [Phaseolus vulgaris] gi|593798058|ref|XP_007162067.1| hypothetical protein PHAVU_001G120800g [Phaseolus vulgaris] gi|561035530|gb|ESW34060.1| hypothetical protein PHAVU_001G120800g [Phaseolus vulgaris] gi|561035531|gb|ESW34061.1| hypothetical protein PHAVU_001G120800g [Phaseolus vulgaris] Length = 73 Score = 72.0 bits (175), Expect = 1e-10 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = -1 Query: 481 MDPESSRTARESLDLAFHMSNILDTGLDRHTLSILIAL 368 MDPE++R ARESLDLAFHMSNILDTGLDRHTLS+LIAL Sbjct: 1 MDPEAARAARESLDLAFHMSNILDTGLDRHTLSVLIAL 38 >ref|XP_007036711.1| AtGCP3 interacting protein 1 [Theobroma cacao] gi|508773956|gb|EOY21212.1| AtGCP3 interacting protein 1 [Theobroma cacao] Length = 73 Score = 71.6 bits (174), Expect = 1e-10 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = -1 Query: 481 MDPESSRTARESLDLAFHMSNILDTGLDRHTLSILIAL 368 MDPE++RTARESLDLAFHMS ILDTGLDRHTLS+LIAL Sbjct: 1 MDPEAARTARESLDLAFHMSKILDTGLDRHTLSVLIAL 38 >gb|AFK42464.1| unknown [Lotus japonicus] Length = 74 Score = 71.6 bits (174), Expect = 1e-10 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = -1 Query: 481 MDPESSRTARESLDLAFHMSNILDTGLDRHTLSILIAL 368 MDPE++R ARESLDLAFHMSNILDTGLDRHTLS+LIAL Sbjct: 1 MDPEAARIARESLDLAFHMSNILDTGLDRHTLSVLIAL 38 >gb|AFK35562.1| unknown [Medicago truncatula] Length = 71 Score = 70.9 bits (172), Expect = 2e-10 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = -1 Query: 481 MDPESSRTARESLDLAFHMSNILDTGLDRHTLSILIAL 368 MDPE++R+ARESLDLAFHMSNILDTGLDRH LSILIAL Sbjct: 1 MDPEAARSARESLDLAFHMSNILDTGLDRHALSILIAL 38 >ref|XP_003609888.1| hypothetical protein MTR_4g124060 [Medicago truncatula] gi|355510943|gb|AES92085.1| hypothetical protein MTR_4g124060 [Medicago truncatula] gi|388503742|gb|AFK39937.1| unknown [Medicago truncatula] Length = 71 Score = 70.9 bits (172), Expect = 2e-10 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = -1 Query: 481 MDPESSRTARESLDLAFHMSNILDTGLDRHTLSILIAL 368 MDPE++R+ARESLDLAFHMSNILDTGLDRH LSILIAL Sbjct: 1 MDPEAARSARESLDLAFHMSNILDTGLDRHALSILIAL 38 >emb|CBI32803.3| unnamed protein product [Vitis vinifera] Length = 107 Score = 69.7 bits (169), Expect = 5e-10 Identities = 33/43 (76%), Positives = 39/43 (90%) Frame = -1 Query: 496 FGVLDMDPESSRTARESLDLAFHMSNILDTGLDRHTLSILIAL 368 F + MDPE+++TARESL+LAFHMSNILDTGLDRHTLS+LI L Sbjct: 30 FQSICMDPEAAQTARESLELAFHMSNILDTGLDRHTLSVLITL 72 >ref|XP_004492490.1| PREDICTED: mitotic-spindle organizing protein 1B-like [Cicer arietinum] Length = 63 Score = 69.3 bits (168), Expect = 7e-10 Identities = 33/38 (86%), Positives = 38/38 (100%) Frame = -1 Query: 481 MDPESSRTARESLDLAFHMSNILDTGLDRHTLSILIAL 368 MDPE++R+ARESLDLAFHMSNIL+TGLDRH+LSILIAL Sbjct: 1 MDPEAARSARESLDLAFHMSNILNTGLDRHSLSILIAL 38 >ref|XP_002283004.1| PREDICTED: mitotic-spindle organizing protein 1B-like [Vitis vinifera] Length = 73 Score = 69.3 bits (168), Expect = 7e-10 Identities = 32/38 (84%), Positives = 37/38 (97%) Frame = -1 Query: 481 MDPESSRTARESLDLAFHMSNILDTGLDRHTLSILIAL 368 MDPE+++TARESL+LAFHMSNILDTGLDRHTLS+LI L Sbjct: 1 MDPEAAQTARESLELAFHMSNILDTGLDRHTLSVLITL 38 >ref|XP_002323237.1| hypothetical protein POPTR_0016s03370g [Populus trichocarpa] gi|566208464|ref|XP_006373698.1| hypothetical protein POPTR_0016s03370g [Populus trichocarpa] gi|566208466|ref|XP_006373699.1| hypothetical protein POPTR_0016s03370g [Populus trichocarpa] gi|118481729|gb|ABK92804.1| unknown [Populus trichocarpa] gi|222867867|gb|EEF04998.1| hypothetical protein POPTR_0016s03370g [Populus trichocarpa] gi|550320731|gb|ERP51495.1| hypothetical protein POPTR_0016s03370g [Populus trichocarpa] gi|550320732|gb|ERP51496.1| hypothetical protein POPTR_0016s03370g [Populus trichocarpa] Length = 74 Score = 68.9 bits (167), Expect = 9e-10 Identities = 31/38 (81%), Positives = 38/38 (100%) Frame = -1 Query: 481 MDPESSRTARESLDLAFHMSNILDTGLDRHTLSILIAL 368 MDPE+++TAR+SL+LAFHMSN+LDTGLDRHTLS+LIAL Sbjct: 1 MDPEAAKTARDSLNLAFHMSNLLDTGLDRHTLSVLIAL 38 >ref|XP_002308877.1| hypothetical protein POPTR_0006s03430g [Populus trichocarpa] gi|118482237|gb|ABK93046.1| unknown [Populus trichocarpa] gi|222854853|gb|EEE92400.1| hypothetical protein POPTR_0006s03430g [Populus trichocarpa] Length = 70 Score = 68.6 bits (166), Expect = 1e-09 Identities = 31/38 (81%), Positives = 37/38 (97%) Frame = -1 Query: 481 MDPESSRTARESLDLAFHMSNILDTGLDRHTLSILIAL 368 MDPE+++TARESLDL FHMSN+L+TGLDRHTLS+LIAL Sbjct: 1 MDPEAAKTARESLDLTFHMSNLLNTGLDRHTLSVLIAL 38 >ref|XP_006347344.1| PREDICTED: mitotic-spindle organizing protein 1B-like isoform X1 [Solanum tuberosum] gi|565361198|ref|XP_006347345.1| PREDICTED: mitotic-spindle organizing protein 1B-like isoform X2 [Solanum tuberosum] Length = 73 Score = 67.8 bits (164), Expect = 2e-09 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = -1 Query: 481 MDPESSRTARESLDLAFHMSNILDTGLDRHTLSILIAL 368 MDPE++R AR+SLDL FHMSNILDTGLDRH+LS+LIAL Sbjct: 1 MDPEAARNARDSLDLVFHMSNILDTGLDRHSLSVLIAL 38 >ref|XP_004241447.1| PREDICTED: mitotic-spindle organizing protein 1B-like [Solanum lycopersicum] Length = 73 Score = 67.8 bits (164), Expect = 2e-09 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = -1 Query: 481 MDPESSRTARESLDLAFHMSNILDTGLDRHTLSILIAL 368 MDPE++R AR+SLDL FHMSNILDTGLDRH LSILIAL Sbjct: 1 MDPEAARNARDSLDLVFHMSNILDTGLDRHALSILIAL 38 >ref|XP_004138897.1| PREDICTED: mitotic-spindle organizing protein 1B-like isoform 1 [Cucumis sativus] gi|449442257|ref|XP_004138898.1| PREDICTED: mitotic-spindle organizing protein 1B-like isoform 2 [Cucumis sativus] gi|449477773|ref|XP_004155118.1| PREDICTED: mitotic-spindle organizing protein 1B-like isoform 1 [Cucumis sativus] gi|449477777|ref|XP_004155119.1| PREDICTED: mitotic-spindle organizing protein 1B-like isoform 2 [Cucumis sativus] Length = 71 Score = 67.8 bits (164), Expect = 2e-09 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = -1 Query: 481 MDPESSRTARESLDLAFHMSNILDTGLDRHTLSILIAL 368 MD E++RTARESLDLAFHMSN+LD G+DRHTLS+LIAL Sbjct: 1 MDQEAARTARESLDLAFHMSNVLDAGIDRHTLSVLIAL 38 >ref|XP_002270835.1| PREDICTED: mitotic-spindle organizing protein 1B isoform 1 [Vitis vinifera] gi|297740900|emb|CBI31082.3| unnamed protein product [Vitis vinifera] Length = 73 Score = 67.8 bits (164), Expect = 2e-09 Identities = 30/38 (78%), Positives = 37/38 (97%) Frame = -1 Query: 481 MDPESSRTARESLDLAFHMSNILDTGLDRHTLSILIAL 368 MDPE+S+TARE+LDL FHMSNIL+TGLDRHT+S+L+AL Sbjct: 1 MDPEASQTAREALDLTFHMSNILETGLDRHTVSVLVAL 38 >ref|XP_004235364.1| PREDICTED: mitotic-spindle organizing protein 1B-like [Solanum lycopersicum] gi|565361754|ref|XP_006347618.1| PREDICTED: mitotic-spindle organizing protein 1B-like [Solanum tuberosum] Length = 76 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/38 (78%), Positives = 37/38 (97%) Frame = -1 Query: 481 MDPESSRTARESLDLAFHMSNILDTGLDRHTLSILIAL 368 MDPE++RTAR+SL+L FHMSNILDTGLDRH+LS+LI+L Sbjct: 1 MDPEAARTARDSLELVFHMSNILDTGLDRHSLSVLISL 38