BLASTX nr result
ID: Akebia25_contig00002521
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00002521 (425 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006382625.1| hypothetical protein POPTR_0005s03900g [Popu... 60 4e-07 >ref|XP_006382625.1| hypothetical protein POPTR_0005s03900g [Populus trichocarpa] gi|550337989|gb|ERP60422.1| hypothetical protein POPTR_0005s03900g [Populus trichocarpa] Length = 385 Score = 59.7 bits (143), Expect = 4e-07 Identities = 32/48 (66%), Positives = 35/48 (72%), Gaps = 2/48 (4%) Frame = -1 Query: 212 GSIRPTNRSQLSRRTI--RNLDPSMIQTFPTFIYSDEKGLKIGKGALE 75 GSIRP LSRR R LDP++I+TFPT IYS KGLKIGKGALE Sbjct: 81 GSIRPLGMGGLSRRVAASRGLDPAVIETFPTLIYSVVKGLKIGKGALE 128