BLASTX nr result
ID: Akebia25_contig00002384
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00002384 (563 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC02053.1| Ethylene-responsive transcription factor 2 [Morus... 63 6e-08 dbj|BAA32418.1| ethylene responsive element binding factor 1 [Ar... 63 6e-08 pdb|2GCC|A Chain A, Solution Structure Of The Gcc-Box Binding Do... 63 6e-08 ref|NP_567530.4| ethylene-responsive transcription factor 1A [Ar... 63 6e-08 ref|XP_006398419.1| hypothetical protein EUTSA_v10001003mg [Eutr... 63 6e-08 ref|XP_007039732.1| AP2/ERF domain-containing transcription fact... 63 6e-08 ref|XP_004508948.1| PREDICTED: ethylene-responsive transcription... 63 6e-08 ref|XP_006284323.1| hypothetical protein CARUB_v10005497mg [Caps... 63 6e-08 ref|XP_006279696.1| hypothetical protein CARUB_v10027108mg [Caps... 63 6e-08 ref|XP_004300354.1| PREDICTED: ethylene-responsive transcription... 63 6e-08 ref|XP_007209449.1| hypothetical protein PRUPE_ppa009707mg [Prun... 63 6e-08 gb|ABD65036.1| ethylene responsive element binding factor, putat... 63 6e-08 gb|AAX07459.1| ethylene-responsive element binding protein ERF5 ... 63 6e-08 emb|CAB45963.1| EREBP-2 protein [Arabidopsis thaliana] gi|726850... 63 6e-08 ref|NP_199533.1| ethylene-responsive transcription factor 2 [Ara... 63 6e-08 gb|ADU76349.1| ethylene responsive factor, partial [Prunus persica] 63 6e-08 gb|ACJ54440.1| AP2/EREBP transcription factor [Gossypium hirsutum] 63 6e-08 ref|XP_002270581.2| PREDICTED: ethylene-responsive transcription... 63 6e-08 ref|XP_003524070.1| PREDICTED: ethylene-responsive transcription... 63 6e-08 ref|XP_003549934.1| PREDICTED: ethylene-responsive transcription... 63 6e-08 >gb|EXC02053.1| Ethylene-responsive transcription factor 2 [Morus notabilis] Length = 289 Score = 62.8 bits (151), Expect = 6e-08 Identities = 32/48 (66%), Positives = 32/48 (66%) Frame = +3 Query: 3 DPAKNGARVWLGTFVTAEXXXXXXXXXXXXXXGSRALLNFPLRVNSAE 146 DPAKNGARVWLGTF TAE GSRALLNFPLRVNS E Sbjct: 162 DPAKNGARVWLGTFETAEDAALAYDRAAYRMRGSRALLNFPLRVNSGE 209 >dbj|BAA32418.1| ethylene responsive element binding factor 1 [Arabidopsis thaliana] Length = 266 Score = 62.8 bits (151), Expect = 6e-08 Identities = 32/48 (66%), Positives = 32/48 (66%) Frame = +3 Query: 3 DPAKNGARVWLGTFVTAEXXXXXXXXXXXXXXGSRALLNFPLRVNSAE 146 DPAKNGARVWLGTF TAE GSRALLNFPLRVNS E Sbjct: 163 DPAKNGARVWLGTFETAEDAALAYDRAAFRMRGSRALLNFPLRVNSGE 210 >pdb|2GCC|A Chain A, Solution Structure Of The Gcc-Box Binding Domain, Nmr, Minimized Mean Structure gi|157836812|pdb|3GCC|A Chain A, Solution Structure Of The Gcc-Box Binding Domain, Nmr, 46 Structures Length = 70 Score = 62.8 bits (151), Expect = 6e-08 Identities = 32/48 (66%), Positives = 32/48 (66%) Frame = +3 Query: 3 DPAKNGARVWLGTFVTAEXXXXXXXXXXXXXXGSRALLNFPLRVNSAE 146 DPAKNGARVWLGTF TAE GSRALLNFPLRVNS E Sbjct: 23 DPAKNGARVWLGTFETAEDAALAYDRAAFRMRGSRALLNFPLRVNSGE 70 >ref|NP_567530.4| ethylene-responsive transcription factor 1A [Arabidopsis thaliana] gi|21264420|sp|O80337.2|EF100_ARATH RecName: Full=Ethylene-responsive transcription factor 1A; Short=AtERF1A; AltName: Full=Ethylene-responsive element-binding factor 1A; Short=EREBP-1A gi|16648795|gb|AAL25588.1| AT4g17500/dl4785w [Arabidopsis thaliana] gi|17064914|gb|AAL32611.1| Unknown protein [Arabidopsis thaliana] gi|27311945|gb|AAO00938.1| Unknown protein [Arabidopsis thaliana] gi|332658503|gb|AEE83903.1| ethylene-responsive transcription factor 1A [Arabidopsis thaliana] Length = 268 Score = 62.8 bits (151), Expect = 6e-08 Identities = 32/48 (66%), Positives = 32/48 (66%) Frame = +3 Query: 3 DPAKNGARVWLGTFVTAEXXXXXXXXXXXXXXGSRALLNFPLRVNSAE 146 DPAKNGARVWLGTF TAE GSRALLNFPLRVNS E Sbjct: 165 DPAKNGARVWLGTFETAEDAALAYDRAAFRMRGSRALLNFPLRVNSGE 212 >ref|XP_006398419.1| hypothetical protein EUTSA_v10001003mg [Eutrema salsugineum] gi|557099508|gb|ESQ39872.1| hypothetical protein EUTSA_v10001003mg [Eutrema salsugineum] Length = 252 Score = 62.8 bits (151), Expect = 6e-08 Identities = 32/48 (66%), Positives = 32/48 (66%) Frame = +3 Query: 3 DPAKNGARVWLGTFVTAEXXXXXXXXXXXXXXGSRALLNFPLRVNSAE 146 DPAKNGARVWLGTF TAE GSRALLNFPLRVNS E Sbjct: 158 DPAKNGARVWLGTFETAEDAALAYDRAAFRMRGSRALLNFPLRVNSGE 205 >ref|XP_007039732.1| AP2/ERF domain-containing transcription factor, putative [Theobroma cacao] gi|508776977|gb|EOY24233.1| AP2/ERF domain-containing transcription factor, putative [Theobroma cacao] Length = 271 Score = 62.8 bits (151), Expect = 6e-08 Identities = 32/48 (66%), Positives = 32/48 (66%) Frame = +3 Query: 3 DPAKNGARVWLGTFVTAEXXXXXXXXXXXXXXGSRALLNFPLRVNSAE 146 DPAKNGARVWLGTF TAE GSRALLNFPLRVNS E Sbjct: 154 DPAKNGARVWLGTFETAEDAALAYDRAAYRMRGSRALLNFPLRVNSGE 201 >ref|XP_004508948.1| PREDICTED: ethylene-responsive transcription factor 1A-like [Cicer arietinum] Length = 265 Score = 62.8 bits (151), Expect = 6e-08 Identities = 32/48 (66%), Positives = 32/48 (66%) Frame = +3 Query: 3 DPAKNGARVWLGTFVTAEXXXXXXXXXXXXXXGSRALLNFPLRVNSAE 146 DPAKNGARVWLGTF TAE GSRALLNFPLRVNS E Sbjct: 162 DPAKNGARVWLGTFETAEDAALAYDKAAYRMRGSRALLNFPLRVNSGE 209 >ref|XP_006284323.1| hypothetical protein CARUB_v10005497mg [Capsella rubella] gi|482553028|gb|EOA17221.1| hypothetical protein CARUB_v10005497mg [Capsella rubella] Length = 268 Score = 62.8 bits (151), Expect = 6e-08 Identities = 32/48 (66%), Positives = 32/48 (66%) Frame = +3 Query: 3 DPAKNGARVWLGTFVTAEXXXXXXXXXXXXXXGSRALLNFPLRVNSAE 146 DPAKNGARVWLGTF TAE GSRALLNFPLRVNS E Sbjct: 168 DPAKNGARVWLGTFETAEDAALAYDRAAFRMRGSRALLNFPLRVNSGE 215 >ref|XP_006279696.1| hypothetical protein CARUB_v10027108mg [Capsella rubella] gi|482548400|gb|EOA12594.1| hypothetical protein CARUB_v10027108mg [Capsella rubella] Length = 217 Score = 62.8 bits (151), Expect = 6e-08 Identities = 32/48 (66%), Positives = 32/48 (66%) Frame = +3 Query: 3 DPAKNGARVWLGTFVTAEXXXXXXXXXXXXXXGSRALLNFPLRVNSAE 146 DPAKNGARVWLGTF TAE GSRALLNFPLRVNS E Sbjct: 132 DPAKNGARVWLGTFETAEDAALAYDRAAFRMRGSRALLNFPLRVNSGE 179 >ref|XP_004300354.1| PREDICTED: ethylene-responsive transcription factor 1A-like [Fragaria vesca subsp. vesca] Length = 296 Score = 62.8 bits (151), Expect = 6e-08 Identities = 32/48 (66%), Positives = 32/48 (66%) Frame = +3 Query: 3 DPAKNGARVWLGTFVTAEXXXXXXXXXXXXXXGSRALLNFPLRVNSAE 146 DPAKNGARVWLGTF TAE GSRALLNFPLRVNS E Sbjct: 175 DPAKNGARVWLGTFETAEDAALAYDRAAYRMRGSRALLNFPLRVNSGE 222 >ref|XP_007209449.1| hypothetical protein PRUPE_ppa009707mg [Prunus persica] gi|462405184|gb|EMJ10648.1| hypothetical protein PRUPE_ppa009707mg [Prunus persica] Length = 281 Score = 62.8 bits (151), Expect = 6e-08 Identities = 32/48 (66%), Positives = 32/48 (66%) Frame = +3 Query: 3 DPAKNGARVWLGTFVTAEXXXXXXXXXXXXXXGSRALLNFPLRVNSAE 146 DPAKNGARVWLGTF TAE GSRALLNFPLRVNS E Sbjct: 166 DPAKNGARVWLGTFETAEDAALAYDRAAYRMRGSRALLNFPLRVNSGE 213 >gb|ABD65036.1| ethylene responsive element binding factor, putative [Brassica oleracea] gi|264913788|gb|ACY74388.1| ERF2 transcription factor [Brassica napus] gi|264913819|gb|ACY74389.1| ERF2 transcription factor [Brassica carinata] Length = 232 Score = 62.8 bits (151), Expect = 6e-08 Identities = 32/48 (66%), Positives = 32/48 (66%) Frame = +3 Query: 3 DPAKNGARVWLGTFVTAEXXXXXXXXXXXXXXGSRALLNFPLRVNSAE 146 DPAKNGARVWLGTF TAE GSRALLNFPLRVNS E Sbjct: 140 DPAKNGARVWLGTFETAEDAAFAYDRAAFRMRGSRALLNFPLRVNSGE 187 >gb|AAX07459.1| ethylene-responsive element binding protein ERF5 [Gossypium hirsutum] Length = 179 Score = 62.8 bits (151), Expect = 6e-08 Identities = 32/48 (66%), Positives = 32/48 (66%) Frame = +3 Query: 3 DPAKNGARVWLGTFVTAEXXXXXXXXXXXXXXGSRALLNFPLRVNSAE 146 DPAKNGARVWLGTF TAE GSRALLNFPLRVNS E Sbjct: 80 DPAKNGARVWLGTFETAEDAALAYDKAAYRMRGSRALLNFPLRVNSGE 127 >emb|CAB45963.1| EREBP-2 protein [Arabidopsis thaliana] gi|7268502|emb|CAB78753.1| EREBP-2 protein [Arabidopsis thaliana] Length = 225 Score = 62.8 bits (151), Expect = 6e-08 Identities = 32/48 (66%), Positives = 32/48 (66%) Frame = +3 Query: 3 DPAKNGARVWLGTFVTAEXXXXXXXXXXXXXXGSRALLNFPLRVNSAE 146 DPAKNGARVWLGTF TAE GSRALLNFPLRVNS E Sbjct: 122 DPAKNGARVWLGTFETAEDAALAYDRAAFRMRGSRALLNFPLRVNSGE 169 >ref|NP_199533.1| ethylene-responsive transcription factor 2 [Arabidopsis thaliana] gi|7531108|sp|O80338.1|EF101_ARATH RecName: Full=Ethylene-responsive transcription factor 2; Short=AtERF2; AltName: Full=Ethylene-responsive element-binding factor 2; Short=EREBP-2 gi|3434969|dbj|BAA32419.1| ethylene responsive element binding factor 2 [Arabidopsis thaliana] gi|8809604|dbj|BAA97155.1| ethylene responsive element binding factor 2 (ATERF2) [Arabidopsis thaliana] gi|51968444|dbj|BAD42914.1| ethylene responsive element binding factor 2 (ATERF2) [Arabidopsis thaliana] gi|51968600|dbj|BAD42992.1| ethylene responsive element binding factor 2 [Arabidopsis thaliana] gi|51971206|dbj|BAD44295.1| ethylene responsive element binding factor 2 (ATERF2) [Arabidopsis thaliana] gi|51971409|dbj|BAD44369.1| ethylene responsive element binding factor 2 (ATERF2) [Arabidopsis thaliana] gi|51971847|dbj|BAD44588.1| ethylene responsive element binding factor 2 (ATERF2) [Arabidopsis thaliana] gi|87116574|gb|ABD19651.1| At5g47220 [Arabidopsis thaliana] gi|332008104|gb|AED95487.1| ethylene-responsive transcription factor 2 [Arabidopsis thaliana] Length = 243 Score = 62.8 bits (151), Expect = 6e-08 Identities = 32/48 (66%), Positives = 32/48 (66%) Frame = +3 Query: 3 DPAKNGARVWLGTFVTAEXXXXXXXXXXXXXXGSRALLNFPLRVNSAE 146 DPAKNGARVWLGTF TAE GSRALLNFPLRVNS E Sbjct: 134 DPAKNGARVWLGTFETAEDAALAYDIAAFRMRGSRALLNFPLRVNSGE 181 >gb|ADU76349.1| ethylene responsive factor, partial [Prunus persica] Length = 287 Score = 62.8 bits (151), Expect = 6e-08 Identities = 32/48 (66%), Positives = 32/48 (66%) Frame = +3 Query: 3 DPAKNGARVWLGTFVTAEXXXXXXXXXXXXXXGSRALLNFPLRVNSAE 146 DPAKNGARVWLGTF TAE GSRALLNFPLRVNS E Sbjct: 172 DPAKNGARVWLGTFETAEDAALAYDRAAYRMRGSRALLNFPLRVNSGE 219 >gb|ACJ54440.1| AP2/EREBP transcription factor [Gossypium hirsutum] Length = 255 Score = 62.8 bits (151), Expect = 6e-08 Identities = 32/48 (66%), Positives = 32/48 (66%) Frame = +3 Query: 3 DPAKNGARVWLGTFVTAEXXXXXXXXXXXXXXGSRALLNFPLRVNSAE 146 DPAKNGARVWLGTF TAE GSRALLNFPLRVNS E Sbjct: 156 DPAKNGARVWLGTFETAEDAALAYDKAAYRMRGSRALLNFPLRVNSGE 203 >ref|XP_002270581.2| PREDICTED: ethylene-responsive transcription factor 2-like [Vitis vinifera] Length = 282 Score = 62.8 bits (151), Expect = 6e-08 Identities = 32/48 (66%), Positives = 32/48 (66%) Frame = +3 Query: 3 DPAKNGARVWLGTFVTAEXXXXXXXXXXXXXXGSRALLNFPLRVNSAE 146 DPAKNGARVWLGTF TAE GSRALLNFPLRVNS E Sbjct: 155 DPAKNGARVWLGTFETAEDAALAYDRAAYRMRGSRALLNFPLRVNSGE 202 >ref|XP_003524070.1| PREDICTED: ethylene-responsive transcription factor 1A-like [Glycine max] Length = 255 Score = 62.8 bits (151), Expect = 6e-08 Identities = 32/48 (66%), Positives = 32/48 (66%) Frame = +3 Query: 3 DPAKNGARVWLGTFVTAEXXXXXXXXXXXXXXGSRALLNFPLRVNSAE 146 DPAKNGARVWLGTF TAE GSRALLNFPLRVNS E Sbjct: 155 DPAKNGARVWLGTFETAEDAALAYDRAAYRMRGSRALLNFPLRVNSGE 202 >ref|XP_003549934.1| PREDICTED: ethylene-responsive transcription factor 1A-like [Glycine max] Length = 251 Score = 62.8 bits (151), Expect = 6e-08 Identities = 32/48 (66%), Positives = 32/48 (66%) Frame = +3 Query: 3 DPAKNGARVWLGTFVTAEXXXXXXXXXXXXXXGSRALLNFPLRVNSAE 146 DPAKNGARVWLGTF TAE GSRALLNFPLRVNS E Sbjct: 151 DPAKNGARVWLGTFETAEDAALAYDRAAYRMRGSRALLNFPLRVNSGE 198