BLASTX nr result
ID: Akebia25_contig00000748
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00000748 (610 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515319.1| conserved hypothetical protein [Ricinus comm... 66 7e-09 >ref|XP_002515319.1| conserved hypothetical protein [Ricinus communis] gi|223545799|gb|EEF47303.1| conserved hypothetical protein [Ricinus communis] Length = 83 Score = 66.2 bits (160), Expect = 7e-09 Identities = 35/65 (53%), Positives = 45/65 (69%), Gaps = 4/65 (6%) Frame = -2 Query: 333 MASEKVDAEFSDTHTSNNQEIVSERPSNNQG----THLGRTVAQRALYGSNRRRIGSRKV 166 MA+EK +AE S+THT NQE +E SN++ G+ +A RALYGS+ RR GSRKV Sbjct: 1 MATEKANAEVSNTHTDGNQEKSAESSSNSKEFTAPPRFGKALAHRALYGSSSRRAGSRKV 60 Query: 165 RNNDT 151 R+NDT Sbjct: 61 RDNDT 65