BLASTX nr result
ID: Akebia25_contig00000628
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00000628 (228 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007023447.1| Cyclic nucleotide gated channel 8 [Theobroma... 57 1e-07 ref|XP_002264161.1| PREDICTED: putative cyclic nucleotide-gated ... 56 5e-07 emb|CBI25178.3| unnamed protein product [Vitis vinifera] 56 5e-07 ref|XP_004147453.1| PREDICTED: putative cyclic nucleotide-gated ... 55 1e-06 ref|XP_002512726.1| Cyclic nucleotide-gated ion channel, putativ... 55 2e-06 ref|XP_006830662.1| hypothetical protein AMTR_s00210p00019190 [A... 55 2e-06 >ref|XP_007023447.1| Cyclic nucleotide gated channel 8 [Theobroma cacao] gi|508778813|gb|EOY26069.1| Cyclic nucleotide gated channel 8 [Theobroma cacao] Length = 752 Score = 57.0 bits (136), Expect(2) = 1e-07 Identities = 27/58 (46%), Positives = 34/58 (58%) Frame = -2 Query: 227 WYMLASHVGTKVSGT*LDCLSFLVLLAVECNNACWQKDCITSEKCDTSYLYCANCHME 54 WYMLASH+ +F LLAVE N+ CW+ CI S KC+ +LYC N HM+ Sbjct: 280 WYMLASHIVG----------AFWYLLAVERNDTCWRNACIGSGKCNIDFLYCGNKHMQ 327 Score = 24.6 bits (52), Expect(2) = 1e-07 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -1 Query: 54 GYATWHSISEVVFNKECS 1 GYA W +SE + +CS Sbjct: 328 GYADWRMVSENILGSKCS 345 >ref|XP_002264161.1| PREDICTED: putative cyclic nucleotide-gated ion channel 8-like [Vitis vinifera] Length = 743 Score = 56.2 bits (134), Expect(2) = 5e-07 Identities = 26/58 (44%), Positives = 34/58 (58%) Frame = -2 Query: 227 WYMLASHVGTKVSGT*LDCLSFLVLLAVECNNACWQKDCITSEKCDTSYLYCANCHME 54 WYMLASH+ +F L AVE +ACW K C+ S KC+ ++LYC N HM+ Sbjct: 278 WYMLASHI----------LGAFWYLFAVERYDACWHKACVESGKCEVNFLYCGNQHMK 325 Score = 23.1 bits (48), Expect(2) = 5e-07 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -1 Query: 54 GYATWHSISEVVFNKECS 1 GY W +IS+ V CS Sbjct: 326 GYGAWQNISKTVIGMMCS 343 >emb|CBI25178.3| unnamed protein product [Vitis vinifera] Length = 719 Score = 56.2 bits (134), Expect(2) = 5e-07 Identities = 26/58 (44%), Positives = 34/58 (58%) Frame = -2 Query: 227 WYMLASHVGTKVSGT*LDCLSFLVLLAVECNNACWQKDCITSEKCDTSYLYCANCHME 54 WYMLASH+ +F L AVE +ACW K C+ S KC+ ++LYC N HM+ Sbjct: 278 WYMLASHI----------LGAFWYLFAVERYDACWHKACVESGKCEVNFLYCGNQHMK 325 Score = 23.1 bits (48), Expect(2) = 5e-07 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -1 Query: 54 GYATWHSISEVVFNKECS 1 GY W +IS+ V CS Sbjct: 326 GYGAWQNISKTVIGMMCS 343 >ref|XP_004147453.1| PREDICTED: putative cyclic nucleotide-gated ion channel 8-like [Cucumis sativus] gi|449528215|ref|XP_004171101.1| PREDICTED: putative cyclic nucleotide-gated ion channel 8-like [Cucumis sativus] Length = 731 Score = 55.5 bits (132), Expect(2) = 1e-06 Identities = 27/56 (48%), Positives = 35/56 (62%) Frame = -2 Query: 224 YMLASHVGTKVSGT*LDCLSFLVLLAVECNNACWQKDCITSEKCDTSYLYCANCHM 57 YMLASH+ +F LLAVE N+ACW++ C +S KC+ +YLYC N HM Sbjct: 285 YMLASHIAG----------AFWYLLAVERNDACWRQACKSSGKCNINYLYCGNKHM 330 Score = 22.7 bits (47), Expect(2) = 1e-06 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -1 Query: 54 GYATWHSISEVVFNKECS 1 GY W +IS V K+C+ Sbjct: 332 GYKAWRNISVDVLTKKCT 349 >ref|XP_002512726.1| Cyclic nucleotide-gated ion channel, putative [Ricinus communis] gi|223547737|gb|EEF49229.1| Cyclic nucleotide-gated ion channel, putative [Ricinus communis] Length = 1005 Score = 54.7 bits (130), Expect(2) = 2e-06 Identities = 29/54 (53%), Positives = 33/54 (61%) Frame = -2 Query: 227 WYMLASHVGTKVSGT*LDCLSFLVLLAVECNNACWQKDCITSEKCDTSYLYCAN 66 WYMLASHV SG +F LLAVE + CWQK CI S +C S+LYC N Sbjct: 281 WYMLASHV----SG------AFWYLLAVERKDTCWQKACIQSGRCVISFLYCGN 324 Score = 22.3 bits (46), Expect(2) = 2e-06 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -1 Query: 54 GYATWHSISEVVFNKECS 1 G+ W ISE V +K C+ Sbjct: 329 GFHEWRRISEGVLSKNCN 346 >ref|XP_006830662.1| hypothetical protein AMTR_s00210p00019190 [Amborella trichopoda] gi|548837252|gb|ERM98078.1| hypothetical protein AMTR_s00210p00019190 [Amborella trichopoda] Length = 772 Score = 55.1 bits (131), Expect(2) = 2e-06 Identities = 29/59 (49%), Positives = 36/59 (61%), Gaps = 1/59 (1%) Frame = -2 Query: 227 WYMLASH-VGTKVSGT*LDCLSFLVLLAVECNNACWQKDCITSEKCDTSYLYCANCHME 54 WYMLASH VG +F LLAVE +ACW+ C TS+ C+ SYLYC N ++E Sbjct: 307 WYMLASHMVG-----------AFWYLLAVEREDACWRFACSTSDSCNKSYLYCGNQNLE 354 Score = 21.9 bits (45), Expect(2) = 2e-06 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -1 Query: 54 GYATWHSISEVVFNKECS 1 G+ W SIS+ V + +CS Sbjct: 355 GFQRWSSISKGVLDGQCS 372