BLASTX nr result
ID: Akebia25_contig00000393
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00000393 (500 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535432.1| conserved hypothetical protein [Ricinus comm... 62 6e-08 ref|YP_005090428.1| orf1 gene product (mitochondrion) [Boea hygr... 57 2e-06 >ref|XP_002535432.1| conserved hypothetical protein [Ricinus communis] gi|255597764|ref|XP_002536851.1| conserved hypothetical protein [Ricinus communis] gi|223518343|gb|EEF25532.1| conserved hypothetical protein [Ricinus communis] gi|223523131|gb|EEF26949.1| conserved hypothetical protein [Ricinus communis] Length = 88 Score = 62.4 bits (150), Expect = 6e-08 Identities = 38/70 (54%), Positives = 40/70 (57%), Gaps = 2/70 (2%) Frame = +1 Query: 289 GTEDWSAPQS*AFRFAPPMWSASFLWMEYNNARAPALLAFFTGARLMYHSSRS--*GKES 462 GTEDW AP+S ALLAFFTGAR MYHSSRS GKES Sbjct: 31 GTEDWFAPKS------------------------SALLAFFTGARRMYHSSRSPRSGKES 66 Query: 463 SVCYNLYGNE 492 SVCYNLYG+E Sbjct: 67 SVCYNLYGDE 76 >ref|YP_005090428.1| orf1 gene product (mitochondrion) [Boea hygrometrica] gi|340549501|gb|AEK53322.1| hypothetical protein (mitochondrion) [Boea hygrometrica] Length = 331 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = -2 Query: 493 IHSRKDYNTQKTPYLRSGMSDTSGERR 413 IHSRKDYNTQKTPYLRSGMSDTSG RR Sbjct: 305 IHSRKDYNTQKTPYLRSGMSDTSGARR 331