BLASTX nr result
ID: Akebia25_contig00000239
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00000239 (276 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006843657.1| hypothetical protein AMTR_s00007p00180710 [A... 123 3e-26 ref|XP_001781100.1| predicted protein [Physcomitrella patens] gi... 122 4e-26 gb|ABK25138.1| unknown [Picea sitchensis] 122 4e-26 ref|XP_006594687.1| PREDICTED: coiled-coil domain-containing pro... 122 7e-26 ref|XP_007149323.1| hypothetical protein PHAVU_005G060900g [Phas... 122 7e-26 gb|ACU23145.1| unknown [Glycine max] 122 7e-26 ref|NP_001276289.1| coiled-coil domain-containing protein 94 hom... 122 7e-26 gb|EXB60452.1| hypothetical protein L484_014905 [Morus notabilis] 121 1e-25 ref|XP_006477925.1| PREDICTED: coiled-coil domain-containing pro... 121 1e-25 ref|XP_006442249.1| hypothetical protein CICLE_v10021131mg [Citr... 121 1e-25 ref|XP_002298914.2| hypothetical protein POPTR_0001s38700g [Popu... 121 1e-25 ref|XP_006370046.1| hypothetical protein POPTR_0001s38700g [Popu... 121 1e-25 ref|XP_004488650.1| PREDICTED: coiled-coil domain-containing pro... 121 1e-25 ref|XP_004294098.1| PREDICTED: coiled-coil domain-containing pro... 121 1e-25 ref|XP_007211525.1| hypothetical protein PRUPE_ppa008122mg [Prun... 121 1e-25 ref|XP_003635597.1| PREDICTED: coiled-coil domain-containing pro... 121 1e-25 emb|CBI14833.3| unnamed protein product [Vitis vinifera] 121 1e-25 ref|XP_002518796.1| Coiled-coil domain-containing protein, putat... 121 1e-25 ref|XP_002317366.2| hypothetical protein POPTR_0011s09840g [Popu... 121 1e-25 ref|XP_007033706.1| Family of Uncharacterized protein function [... 120 2e-25 >ref|XP_006843657.1| hypothetical protein AMTR_s00007p00180710 [Amborella trichopoda] gi|548846025|gb|ERN05332.1| hypothetical protein AMTR_s00007p00180710 [Amborella trichopoda] Length = 333 Score = 123 bits (308), Expect = 3e-26 Identities = 55/57 (96%), Positives = 57/57 (100%) Frame = -2 Query: 173 MGERKVLNKYYPPDFDPSKLPRRRQPKNQQIKVRMMLPMSIRCNTCGNYIYKGTKFN 3 MGERKVLNKYYPPDFDPSK+PRRRQPKNQQIKVRMMLPMSIRC+TCGNYIYKGTKFN Sbjct: 1 MGERKVLNKYYPPDFDPSKIPRRRQPKNQQIKVRMMLPMSIRCSTCGNYIYKGTKFN 57 >ref|XP_001781100.1| predicted protein [Physcomitrella patens] gi|162667497|gb|EDQ54126.1| predicted protein [Physcomitrella patens] Length = 263 Score = 122 bits (307), Expect = 4e-26 Identities = 54/57 (94%), Positives = 57/57 (100%) Frame = -2 Query: 173 MGERKVLNKYYPPDFDPSKLPRRRQPKNQQIKVRMMLPMSIRCNTCGNYIYKGTKFN 3 MGERKVLNKYYPPDFDP+K+PRR+QPKNQQIKVRMMLPMSIRCNTCGNYIYKGTKFN Sbjct: 1 MGERKVLNKYYPPDFDPAKIPRRKQPKNQQIKVRMMLPMSIRCNTCGNYIYKGTKFN 57 >gb|ABK25138.1| unknown [Picea sitchensis] Length = 342 Score = 122 bits (307), Expect = 4e-26 Identities = 55/57 (96%), Positives = 56/57 (98%) Frame = -2 Query: 173 MGERKVLNKYYPPDFDPSKLPRRRQPKNQQIKVRMMLPMSIRCNTCGNYIYKGTKFN 3 MGERKVLNKYYPPDFDPSK+PRRRQPKNQQIKVRMMLPMSIRC TCGNYIYKGTKFN Sbjct: 1 MGERKVLNKYYPPDFDPSKIPRRRQPKNQQIKVRMMLPMSIRCGTCGNYIYKGTKFN 57 >ref|XP_006594687.1| PREDICTED: coiled-coil domain-containing protein 94 homolog [Glycine max] Length = 326 Score = 122 bits (305), Expect = 7e-26 Identities = 55/57 (96%), Positives = 56/57 (98%) Frame = -2 Query: 173 MGERKVLNKYYPPDFDPSKLPRRRQPKNQQIKVRMMLPMSIRCNTCGNYIYKGTKFN 3 MGERKVLNKYYPPDFDPSKLPR R+PKNQQIKVRMMLPMSIRCNTCGNYIYKGTKFN Sbjct: 1 MGERKVLNKYYPPDFDPSKLPRARRPKNQQIKVRMMLPMSIRCNTCGNYIYKGTKFN 57 >ref|XP_007149323.1| hypothetical protein PHAVU_005G060900g [Phaseolus vulgaris] gi|561022587|gb|ESW21317.1| hypothetical protein PHAVU_005G060900g [Phaseolus vulgaris] Length = 323 Score = 122 bits (305), Expect = 7e-26 Identities = 55/57 (96%), Positives = 56/57 (98%) Frame = -2 Query: 173 MGERKVLNKYYPPDFDPSKLPRRRQPKNQQIKVRMMLPMSIRCNTCGNYIYKGTKFN 3 MGERKVLNKYYPPDFDPSKLPR R+PKNQQIKVRMMLPMSIRCNTCGNYIYKGTKFN Sbjct: 1 MGERKVLNKYYPPDFDPSKLPRARRPKNQQIKVRMMLPMSIRCNTCGNYIYKGTKFN 57 >gb|ACU23145.1| unknown [Glycine max] Length = 252 Score = 122 bits (305), Expect = 7e-26 Identities = 55/57 (96%), Positives = 56/57 (98%) Frame = -2 Query: 173 MGERKVLNKYYPPDFDPSKLPRRRQPKNQQIKVRMMLPMSIRCNTCGNYIYKGTKFN 3 MGERKVLNKYYPPDFDPSKLPR R+PKNQQIKVRMMLPMSIRCNTCGNYIYKGTKFN Sbjct: 1 MGERKVLNKYYPPDFDPSKLPRARRPKNQQIKVRMMLPMSIRCNTCGNYIYKGTKFN 57 >ref|NP_001276289.1| coiled-coil domain-containing protein 94 homolog [Glycine max] gi|255642439|gb|ACU21483.1| unknown [Glycine max] Length = 326 Score = 122 bits (305), Expect = 7e-26 Identities = 55/57 (96%), Positives = 56/57 (98%) Frame = -2 Query: 173 MGERKVLNKYYPPDFDPSKLPRRRQPKNQQIKVRMMLPMSIRCNTCGNYIYKGTKFN 3 MGERKVLNKYYPPDFDPSKLPR R+PKNQQIKVRMMLPMSIRCNTCGNYIYKGTKFN Sbjct: 1 MGERKVLNKYYPPDFDPSKLPRARRPKNQQIKVRMMLPMSIRCNTCGNYIYKGTKFN 57 >gb|EXB60452.1| hypothetical protein L484_014905 [Morus notabilis] Length = 351 Score = 121 bits (303), Expect = 1e-25 Identities = 55/57 (96%), Positives = 56/57 (98%) Frame = -2 Query: 173 MGERKVLNKYYPPDFDPSKLPRRRQPKNQQIKVRMMLPMSIRCNTCGNYIYKGTKFN 3 MGERKVLNKYYPPDFDPSKLPR R+PKNQQIKVRMMLPMSIRCNTCGNYIYKGTKFN Sbjct: 1 MGERKVLNKYYPPDFDPSKLPRVRRPKNQQIKVRMMLPMSIRCNTCGNYIYKGTKFN 57 >ref|XP_006477925.1| PREDICTED: coiled-coil domain-containing protein 94 homolog [Citrus sinensis] Length = 327 Score = 121 bits (303), Expect = 1e-25 Identities = 55/57 (96%), Positives = 56/57 (98%) Frame = -2 Query: 173 MGERKVLNKYYPPDFDPSKLPRRRQPKNQQIKVRMMLPMSIRCNTCGNYIYKGTKFN 3 MGERKVLNKYYPPDFDPSKLPR R+PKNQQIKVRMMLPMSIRCNTCGNYIYKGTKFN Sbjct: 1 MGERKVLNKYYPPDFDPSKLPRIRRPKNQQIKVRMMLPMSIRCNTCGNYIYKGTKFN 57 >ref|XP_006442249.1| hypothetical protein CICLE_v10021131mg [Citrus clementina] gi|557544511|gb|ESR55489.1| hypothetical protein CICLE_v10021131mg [Citrus clementina] Length = 327 Score = 121 bits (303), Expect = 1e-25 Identities = 55/57 (96%), Positives = 56/57 (98%) Frame = -2 Query: 173 MGERKVLNKYYPPDFDPSKLPRRRQPKNQQIKVRMMLPMSIRCNTCGNYIYKGTKFN 3 MGERKVLNKYYPPDFDPSKLPR R+PKNQQIKVRMMLPMSIRCNTCGNYIYKGTKFN Sbjct: 1 MGERKVLNKYYPPDFDPSKLPRIRRPKNQQIKVRMMLPMSIRCNTCGNYIYKGTKFN 57 >ref|XP_002298914.2| hypothetical protein POPTR_0001s38700g [Populus trichocarpa] gi|550349201|gb|EEE83719.2| hypothetical protein POPTR_0001s38700g [Populus trichocarpa] Length = 327 Score = 121 bits (303), Expect = 1e-25 Identities = 55/57 (96%), Positives = 56/57 (98%) Frame = -2 Query: 173 MGERKVLNKYYPPDFDPSKLPRRRQPKNQQIKVRMMLPMSIRCNTCGNYIYKGTKFN 3 MGERKVLNKYYPPDFDPSKLPR R+PKNQQIKVRMMLPMSIRCNTCGNYIYKGTKFN Sbjct: 1 MGERKVLNKYYPPDFDPSKLPRIRRPKNQQIKVRMMLPMSIRCNTCGNYIYKGTKFN 57 >ref|XP_006370046.1| hypothetical protein POPTR_0001s38700g [Populus trichocarpa] gi|550349200|gb|ERP66615.1| hypothetical protein POPTR_0001s38700g [Populus trichocarpa] Length = 230 Score = 121 bits (303), Expect = 1e-25 Identities = 55/57 (96%), Positives = 56/57 (98%) Frame = -2 Query: 173 MGERKVLNKYYPPDFDPSKLPRRRQPKNQQIKVRMMLPMSIRCNTCGNYIYKGTKFN 3 MGERKVLNKYYPPDFDPSKLPR R+PKNQQIKVRMMLPMSIRCNTCGNYIYKGTKFN Sbjct: 1 MGERKVLNKYYPPDFDPSKLPRIRRPKNQQIKVRMMLPMSIRCNTCGNYIYKGTKFN 57 >ref|XP_004488650.1| PREDICTED: coiled-coil domain-containing protein 94 homolog isoform X1 [Cicer arietinum] gi|502087813|ref|XP_004488651.1| PREDICTED: coiled-coil domain-containing protein 94 homolog isoform X2 [Cicer arietinum] Length = 330 Score = 121 bits (303), Expect = 1e-25 Identities = 55/57 (96%), Positives = 56/57 (98%) Frame = -2 Query: 173 MGERKVLNKYYPPDFDPSKLPRRRQPKNQQIKVRMMLPMSIRCNTCGNYIYKGTKFN 3 MGERKVLNKYYPPDFDPSKLPR R+PKNQQIKVRMMLPMSIRCNTCGNYIYKGTKFN Sbjct: 1 MGERKVLNKYYPPDFDPSKLPRVRRPKNQQIKVRMMLPMSIRCNTCGNYIYKGTKFN 57 >ref|XP_004294098.1| PREDICTED: coiled-coil domain-containing protein 94 homolog [Fragaria vesca subsp. vesca] Length = 353 Score = 121 bits (303), Expect = 1e-25 Identities = 55/57 (96%), Positives = 56/57 (98%) Frame = -2 Query: 173 MGERKVLNKYYPPDFDPSKLPRRRQPKNQQIKVRMMLPMSIRCNTCGNYIYKGTKFN 3 MGERKVLNKYYPPDFDPSKLPR R+PKNQQIKVRMMLPMSIRCNTCGNYIYKGTKFN Sbjct: 1 MGERKVLNKYYPPDFDPSKLPRVRRPKNQQIKVRMMLPMSIRCNTCGNYIYKGTKFN 57 >ref|XP_007211525.1| hypothetical protein PRUPE_ppa008122mg [Prunus persica] gi|462407390|gb|EMJ12724.1| hypothetical protein PRUPE_ppa008122mg [Prunus persica] Length = 344 Score = 121 bits (303), Expect = 1e-25 Identities = 55/57 (96%), Positives = 56/57 (98%) Frame = -2 Query: 173 MGERKVLNKYYPPDFDPSKLPRRRQPKNQQIKVRMMLPMSIRCNTCGNYIYKGTKFN 3 MGERKVLNKYYPPDFDPSKLPR R+PKNQQIKVRMMLPMSIRCNTCGNYIYKGTKFN Sbjct: 1 MGERKVLNKYYPPDFDPSKLPRIRRPKNQQIKVRMMLPMSIRCNTCGNYIYKGTKFN 57 >ref|XP_003635597.1| PREDICTED: coiled-coil domain-containing protein 94 homolog [Vitis vinifera] Length = 184 Score = 121 bits (303), Expect = 1e-25 Identities = 55/57 (96%), Positives = 56/57 (98%) Frame = -2 Query: 173 MGERKVLNKYYPPDFDPSKLPRRRQPKNQQIKVRMMLPMSIRCNTCGNYIYKGTKFN 3 MGERKVLNKYYPPDFDPSKLPR R+PKNQQIKVRMMLPMSIRCNTCGNYIYKGTKFN Sbjct: 1 MGERKVLNKYYPPDFDPSKLPRIRRPKNQQIKVRMMLPMSIRCNTCGNYIYKGTKFN 57 >emb|CBI14833.3| unnamed protein product [Vitis vinifera] Length = 183 Score = 121 bits (303), Expect = 1e-25 Identities = 55/57 (96%), Positives = 56/57 (98%) Frame = -2 Query: 173 MGERKVLNKYYPPDFDPSKLPRRRQPKNQQIKVRMMLPMSIRCNTCGNYIYKGTKFN 3 MGERKVLNKYYPPDFDPSKLPR R+PKNQQIKVRMMLPMSIRCNTCGNYIYKGTKFN Sbjct: 1 MGERKVLNKYYPPDFDPSKLPRIRRPKNQQIKVRMMLPMSIRCNTCGNYIYKGTKFN 57 >ref|XP_002518796.1| Coiled-coil domain-containing protein, putative [Ricinus communis] gi|223542177|gb|EEF43721.1| Coiled-coil domain-containing protein, putative [Ricinus communis] Length = 360 Score = 121 bits (303), Expect = 1e-25 Identities = 55/57 (96%), Positives = 56/57 (98%) Frame = -2 Query: 173 MGERKVLNKYYPPDFDPSKLPRRRQPKNQQIKVRMMLPMSIRCNTCGNYIYKGTKFN 3 MGERKVLNKYYPPDFDPSKLPR R+PKNQQIKVRMMLPMSIRCNTCGNYIYKGTKFN Sbjct: 1 MGERKVLNKYYPPDFDPSKLPRIRRPKNQQIKVRMMLPMSIRCNTCGNYIYKGTKFN 57 >ref|XP_002317366.2| hypothetical protein POPTR_0011s09840g [Populus trichocarpa] gi|118487268|gb|ABK95462.1| unknown [Populus trichocarpa] gi|550328031|gb|EEE97978.2| hypothetical protein POPTR_0011s09840g [Populus trichocarpa] Length = 327 Score = 121 bits (303), Expect = 1e-25 Identities = 55/57 (96%), Positives = 56/57 (98%) Frame = -2 Query: 173 MGERKVLNKYYPPDFDPSKLPRRRQPKNQQIKVRMMLPMSIRCNTCGNYIYKGTKFN 3 MGERKVLNKYYPPDFDPSKLPR R+PKNQQIKVRMMLPMSIRCNTCGNYIYKGTKFN Sbjct: 1 MGERKVLNKYYPPDFDPSKLPRIRRPKNQQIKVRMMLPMSIRCNTCGNYIYKGTKFN 57 >ref|XP_007033706.1| Family of Uncharacterized protein function [Theobroma cacao] gi|508712735|gb|EOY04632.1| Family of Uncharacterized protein function [Theobroma cacao] Length = 315 Score = 120 bits (302), Expect = 2e-25 Identities = 54/57 (94%), Positives = 56/57 (98%) Frame = -2 Query: 173 MGERKVLNKYYPPDFDPSKLPRRRQPKNQQIKVRMMLPMSIRCNTCGNYIYKGTKFN 3 MGERKVLNKYYPPDFDPSKLPR R+PKNQQ+KVRMMLPMSIRCNTCGNYIYKGTKFN Sbjct: 1 MGERKVLNKYYPPDFDPSKLPRARRPKNQQMKVRMMLPMSIRCNTCGNYIYKGTKFN 57