BLASTX nr result
ID: Akebia24_contig00045150
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00045150 (228 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004309237.1| PREDICTED: pentatricopeptide repeat-containi... 80 3e-13 ref|XP_003538647.2| PREDICTED: pentatricopeptide repeat-containi... 79 5e-13 emb|CBI38215.3| unnamed protein product [Vitis vinifera] 78 1e-12 ref|XP_002265179.1| PREDICTED: pentatricopeptide repeat-containi... 78 1e-12 gb|EXC11897.1| hypothetical protein L484_005358 [Morus notabilis] 74 3e-11 ref|XP_002318245.2| hypothetical protein POPTR_0012s13730g, part... 73 4e-11 ref|XP_007225289.1| hypothetical protein PRUPE_ppa001360mg [Prun... 73 4e-11 ref|XP_003553630.1| PREDICTED: pentatricopeptide repeat-containi... 73 4e-11 ref|XP_002277430.1| PREDICTED: pentatricopeptide repeat-containi... 73 4e-11 ref|XP_002519398.1| pentatricopeptide repeat-containing protein,... 73 5e-11 gb|EXB51133.1| hypothetical protein L484_009097 [Morus notabilis] 72 6e-11 ref|XP_007029178.1| Pentatricopeptide repeat (PPR) superfamily p... 72 6e-11 ref|XP_004296686.1| PREDICTED: pentatricopeptide repeat-containi... 72 6e-11 gb|EXC20880.1| hypothetical protein L484_012956 [Morus notabilis] 72 1e-10 ref|XP_007157109.1| hypothetical protein PHAVU_002G043500g [Phas... 72 1e-10 emb|CBI31865.3| unnamed protein product [Vitis vinifera] 72 1e-10 ref|XP_002268072.1| PREDICTED: pentatricopeptide repeat-containi... 72 1e-10 ref|XP_003610748.1| Pentatricopeptide repeat-containing protein ... 71 1e-10 ref|XP_006376134.1| hypothetical protein POPTR_0013s10100g [Popu... 71 2e-10 ref|XP_007029177.1| Pentatricopeptide repeat superfamily protein... 71 2e-10 >ref|XP_004309237.1| PREDICTED: pentatricopeptide repeat-containing protein At4g38010-like [Fragaria vesca subsp. vesca] Length = 581 Score = 80.1 bits (196), Expect = 3e-13 Identities = 33/75 (44%), Positives = 51/75 (68%) Frame = +3 Query: 3 SISIYTQILRAGLLPDVYTIPLLLKACSQVLAFPQGRSVHGQAIKFALASYIYVNNALIH 182 ++ +Y +I+R G +PD++TIP +LK C + L +GR VHG +K A +YV N+L+H Sbjct: 89 AVLVYRRIVRDGFVPDMFTIPAVLKCCVKFLGKGEGRQVHGVVVKMGFACDVYVENSLVH 148 Query: 183 FYSITGNVNDARKLF 227 FYS+ G DA+K+F Sbjct: 149 FYSVCGECGDAKKVF 163 >ref|XP_003538647.2| PREDICTED: pentatricopeptide repeat-containing protein At3g22690-like [Glycine max] Length = 854 Score = 79.3 bits (194), Expect = 5e-13 Identities = 37/75 (49%), Positives = 51/75 (68%) Frame = +3 Query: 3 SISIYTQILRAGLLPDVYTIPLLLKACSQVLAFPQGRSVHGQAIKFALASYIYVNNALIH 182 +I +Y Q+L G++PD YT P LL ACS++LA +G VHG +K L I+V+N+LIH Sbjct: 132 AILLYVQMLVMGIVPDKYTFPFLLSACSKILALSEGVQVHGAVLKMGLEGDIFVSNSLIH 191 Query: 183 FYSITGNVNDARKLF 227 FY+ G V+ RKLF Sbjct: 192 FYAECGKVDLGRKLF 206 >emb|CBI38215.3| unnamed protein product [Vitis vinifera] Length = 595 Score = 78.2 bits (191), Expect = 1e-12 Identities = 35/72 (48%), Positives = 50/72 (69%) Frame = +3 Query: 12 IYTQILRAGLLPDVYTIPLLLKACSQVLAFPQGRSVHGQAIKFALASYIYVNNALIHFYS 191 +Y Q+L G++PD YTIP +LKAC++ A +G VHGQAIK LAS +YV+N L+ Y+ Sbjct: 127 VYKQMLSKGIVPDNYTIPFVLKACAESRAVREGEEVHGQAIKMGLASDVYVSNTLMRMYA 186 Query: 192 ITGNVNDARKLF 227 + + ARK+F Sbjct: 187 VCDVIRSARKVF 198 >ref|XP_002265179.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Vitis vinifera] Length = 617 Score = 78.2 bits (191), Expect = 1e-12 Identities = 35/72 (48%), Positives = 50/72 (69%) Frame = +3 Query: 12 IYTQILRAGLLPDVYTIPLLLKACSQVLAFPQGRSVHGQAIKFALASYIYVNNALIHFYS 191 +Y Q+L G++PD YTIP +LKAC++ A +G VHGQAIK LAS +YV+N L+ Y+ Sbjct: 112 VYKQMLSKGIVPDNYTIPFVLKACAESRAVREGEEVHGQAIKMGLASDVYVSNTLMRMYA 171 Query: 192 ITGNVNDARKLF 227 + + ARK+F Sbjct: 172 VCDVIRSARKVF 183 >gb|EXC11897.1| hypothetical protein L484_005358 [Morus notabilis] Length = 584 Score = 73.6 bits (179), Expect = 3e-11 Identities = 28/75 (37%), Positives = 50/75 (66%) Frame = +3 Query: 3 SISIYTQILRAGLLPDVYTIPLLLKACSQVLAFPQGRSVHGQAIKFALASYIYVNNALIH 182 ++ +Y +I+R G +PD +T P +LK+C++ L +GR VH + + ++YV N+L+H Sbjct: 90 AVLVYRRIVRDGFMPDTFTFPAVLKSCTKFLGIREGRQVHSVIVVMGFSCHVYVQNSLVH 149 Query: 183 FYSITGNVNDARKLF 227 YS+ G+ + ARK+F Sbjct: 150 LYSVCGDCDGARKVF 164 >ref|XP_002318245.2| hypothetical protein POPTR_0012s13730g, partial [Populus trichocarpa] gi|550327071|gb|EEE96465.2| hypothetical protein POPTR_0012s13730g, partial [Populus trichocarpa] Length = 602 Score = 73.2 bits (178), Expect = 4e-11 Identities = 30/72 (41%), Positives = 47/72 (65%) Frame = +3 Query: 12 IYTQILRAGLLPDVYTIPLLLKACSQVLAFPQGRSVHGQAIKFALASYIYVNNALIHFYS 191 +Y +I++ G LPD++T P +LK+C++ + +GR VHG IK IYV N+L+HFYS Sbjct: 96 VYRRIVKDGFLPDMFTFPAVLKSCAKFVGIGEGRQVHGVIIKMGFVCNIYVENSLVHFYS 155 Query: 192 ITGNVNDARKLF 227 + DA ++F Sbjct: 156 VCKRFGDASRVF 167 >ref|XP_007225289.1| hypothetical protein PRUPE_ppa001360mg [Prunus persica] gi|462422225|gb|EMJ26488.1| hypothetical protein PRUPE_ppa001360mg [Prunus persica] Length = 845 Score = 73.2 bits (178), Expect = 4e-11 Identities = 30/75 (40%), Positives = 52/75 (69%) Frame = +3 Query: 3 SISIYTQILRAGLLPDVYTIPLLLKACSQVLAFPQGRSVHGQAIKFALASYIYVNNALIH 182 ++ +Y Q++ G+LPD +T P +L ACS+V+AF +G +HG +K L ++ N+LIH Sbjct: 123 AVLLYVQMVVKGILPDKFTFPFVLSACSKVVAFSEGVQLHGALVKMGLEEDAFIENSLIH 182 Query: 183 FYSITGNVNDARKLF 227 FY+ +G ++ +RK+F Sbjct: 183 FYAESGELDYSRKVF 197 >ref|XP_003553630.1| PREDICTED: pentatricopeptide repeat-containing protein At5g06540-like [Glycine max] Length = 622 Score = 73.2 bits (178), Expect = 4e-11 Identities = 35/75 (46%), Positives = 45/75 (60%) Frame = +3 Query: 3 SISIYTQILRAGLLPDVYTIPLLLKACSQVLAFPQGRSVHGQAIKFALASYIYVNNALIH 182 S Y + LR GLLPD T P L+KAC+Q+ P G HGQAIK YV N+L+H Sbjct: 101 SFHYYIKALRFGLLPDNITHPFLVKACAQLENAPMGMQTHGQAIKHGFEQDFYVQNSLVH 160 Query: 183 FYSITGNVNDARKLF 227 Y+ G++N AR +F Sbjct: 161 MYASVGDINAARSVF 175 >ref|XP_002277430.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Vitis vinifera] Length = 500 Score = 73.2 bits (178), Expect = 4e-11 Identities = 31/75 (41%), Positives = 49/75 (65%) Frame = +3 Query: 3 SISIYTQILRAGLLPDVYTIPLLLKACSQVLAFPQGRSVHGQAIKFALASYIYVNNALIH 182 ++ ++ +LR G PD YT P LLKACS + P+G+ +H QA+KF L +++V N+LIH Sbjct: 72 ALLLHRHMLRHGPPPDTYTFPFLLKACSALAHLPKGQELHCQALKFGLGGHVFVENSLIH 131 Query: 183 FYSITGNVNDARKLF 227 Y ++ AR++F Sbjct: 132 LYGSNSGMDSARRVF 146 >ref|XP_002519398.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223541465|gb|EEF43015.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 615 Score = 72.8 bits (177), Expect = 5e-11 Identities = 33/73 (45%), Positives = 48/73 (65%) Frame = +3 Query: 9 SIYTQILRAGLLPDVYTIPLLLKACSQVLAFPQGRSVHGQAIKFALASYIYVNNALIHFY 188 S+Y Q+L GL PD YT+P LLKACSQ AF + +H +IK L+S ++V N L+ FY Sbjct: 124 SLYRQMLLIGLSPDTYTLPYLLKACSQSHAFIEALQIHAHSIKTGLSSNLFVKNTLMRFY 183 Query: 189 SITGNVNDARKLF 227 +++G + K+F Sbjct: 184 AVSGFIEAVEKVF 196 >gb|EXB51133.1| hypothetical protein L484_009097 [Morus notabilis] Length = 845 Score = 72.4 bits (176), Expect = 6e-11 Identities = 30/75 (40%), Positives = 49/75 (65%) Frame = +3 Query: 3 SISIYTQILRAGLLPDVYTIPLLLKACSQVLAFPQGRSVHGQAIKFALASYIYVNNALIH 182 +IS+Y Q+L G+ PD YT P +L C++ AF +G +HG ++ L +++ N+LIH Sbjct: 123 AISVYVQMLVLGITPDKYTFPFVLSGCAKAEAFREGIQLHGAVVRMGLERDLFIGNSLIH 182 Query: 183 FYSITGNVNDARKLF 227 FY+ G ++ ARK+F Sbjct: 183 FYAECGELDSARKVF 197 >ref|XP_007029178.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] gi|508717783|gb|EOY09680.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] Length = 626 Score = 72.4 bits (176), Expect = 6e-11 Identities = 32/75 (42%), Positives = 46/75 (61%) Frame = +3 Query: 3 SISIYTQILRAGLLPDVYTIPLLLKACSQVLAFPQGRSVHGQAIKFALASYIYVNNALIH 182 S YTQ+LRA +LPD + P L++AC+Q+ + G HGQ IK S +YV N+L+H Sbjct: 106 SFHFYTQLLRANILPDNLSFPFLVRACAQLESLDMGIQAHGQIIKHGFESNVYVQNSLVH 165 Query: 183 FYSITGNVNDARKLF 227 YS G++ A +F Sbjct: 166 MYSTCGDIKAANAIF 180 >ref|XP_004296686.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22690-like [Fragaria vesca subsp. vesca] Length = 843 Score = 72.4 bits (176), Expect = 6e-11 Identities = 32/75 (42%), Positives = 49/75 (65%) Frame = +3 Query: 3 SISIYTQILRAGLLPDVYTIPLLLKACSQVLAFPQGRSVHGQAIKFALASYIYVNNALIH 182 +I +Y Q++ G+ PD +T P L ACS+V+AF +G +HG +K L ++V N+LIH Sbjct: 118 AIGLYVQMVVQGVSPDKFTFPFALSACSKVVAFCEGVQLHGSIVKMGLEGDVFVGNSLIH 177 Query: 183 FYSITGNVNDARKLF 227 FY+ G + ARK+F Sbjct: 178 FYAECGEMGYARKVF 192 >gb|EXC20880.1| hypothetical protein L484_012956 [Morus notabilis] Length = 540 Score = 71.6 bits (174), Expect = 1e-10 Identities = 35/75 (46%), Positives = 48/75 (64%) Frame = +3 Query: 3 SISIYTQILRAGLLPDVYTIPLLLKACSQVLAFPQGRSVHGQAIKFALASYIYVNNALIH 182 S +Y Q+LR G+ PD T P L+K C+ + GRS+HGQ IKF L ++V N+LI+ Sbjct: 107 SFLLYKQMLREGIAPDCLTFPFLVKVCAARVDGFLGRSIHGQVIKFGLCGDVFVQNSLIN 166 Query: 183 FYSITGNVNDARKLF 227 YSI G + ARK+F Sbjct: 167 LYSICGLPSFARKMF 181 >ref|XP_007157109.1| hypothetical protein PHAVU_002G043500g [Phaseolus vulgaris] gi|561030524|gb|ESW29103.1| hypothetical protein PHAVU_002G043500g [Phaseolus vulgaris] Length = 838 Score = 71.6 bits (174), Expect = 1e-10 Identities = 33/75 (44%), Positives = 48/75 (64%) Frame = +3 Query: 3 SISIYTQILRAGLLPDVYTIPLLLKACSQVLAFPQGRSVHGQAIKFALASYIYVNNALIH 182 +I +Y Q++ G++PD YT P LL ACS+ A +G VHG +K L I+V+N+ IH Sbjct: 116 AILLYIQMVGMGIVPDNYTFPFLLSACSKTTALSEGVQVHGVVVKMGLDGDIFVSNSFIH 175 Query: 183 FYSITGNVNDARKLF 227 FY+ G V+ RK+F Sbjct: 176 FYAECGKVDLGRKVF 190 >emb|CBI31865.3| unnamed protein product [Vitis vinifera] Length = 573 Score = 71.6 bits (174), Expect = 1e-10 Identities = 30/72 (41%), Positives = 47/72 (65%) Frame = +3 Query: 12 IYTQILRAGLLPDVYTIPLLLKACSQVLAFPQGRSVHGQAIKFALASYIYVNNALIHFYS 191 +Y +I+ G +PD+YT P++LKAC++ L +G VHG A+K +YV N+L+HFYS Sbjct: 92 VYGRIVGNGFVPDMYTFPVVLKACTKFLGVQEGEQVHGVAVKMGFLCDLYVQNSLLHFYS 151 Query: 192 ITGNVNDARKLF 227 + G A ++F Sbjct: 152 VCGKWGGAGRVF 163 >ref|XP_002268072.1| PREDICTED: pentatricopeptide repeat-containing protein At4g38010-like [Vitis vinifera] Length = 590 Score = 71.6 bits (174), Expect = 1e-10 Identities = 30/72 (41%), Positives = 47/72 (65%) Frame = +3 Query: 12 IYTQILRAGLLPDVYTIPLLLKACSQVLAFPQGRSVHGQAIKFALASYIYVNNALIHFYS 191 +Y +I+ G +PD+YT P++LKAC++ L +G VHG A+K +YV N+L+HFYS Sbjct: 92 VYGRIVGNGFVPDMYTFPVVLKACTKFLGVQEGEQVHGVAVKMGFLCDLYVQNSLLHFYS 151 Query: 192 ITGNVNDARKLF 227 + G A ++F Sbjct: 152 VCGKWGGAGRVF 163 >ref|XP_003610748.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355512083|gb|AES93706.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 828 Score = 71.2 bits (173), Expect = 1e-10 Identities = 34/76 (44%), Positives = 50/76 (65%), Gaps = 1/76 (1%) Frame = +3 Query: 3 SISIYTQ-ILRAGLLPDVYTIPLLLKACSQVLAFPQGRSVHGQAIKFALASYIYVNNALI 179 +I IY I+ G++PD +T P LL ACS+++AF +G VHG +K L ++V N+LI Sbjct: 105 AIFIYLHMIIVMGIVPDNFTFPFLLSACSKIMAFSEGVQVHGVVVKMGLVKDLFVANSLI 164 Query: 180 HFYSITGNVNDARKLF 227 HFY+ G V+ RK+F Sbjct: 165 HFYAACGKVDLGRKVF 180 >ref|XP_006376134.1| hypothetical protein POPTR_0013s10100g [Populus trichocarpa] gi|550325404|gb|ERP53931.1| hypothetical protein POPTR_0013s10100g [Populus trichocarpa] Length = 636 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/75 (41%), Positives = 46/75 (61%) Frame = +3 Query: 3 SISIYTQILRAGLLPDVYTIPLLLKACSQVLAFPQGRSVHGQAIKFALASYIYVNNALIH 182 S +Y ++L G++PD YTIP +LKACS LA +G+ +H IK +YVNN L+ Sbjct: 127 SFHLYQEMLIKGIIPDTYTIPFVLKACSHSLALWEGQQIHAHCIKMFFMENVYVNNTLMR 186 Query: 183 FYSITGNVNDARKLF 227 Y++ G ++ KLF Sbjct: 187 LYAVCGMLDVVEKLF 201 >ref|XP_007029177.1| Pentatricopeptide repeat superfamily protein [Theobroma cacao] gi|508717782|gb|EOY09679.1| Pentatricopeptide repeat superfamily protein [Theobroma cacao] Length = 584 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/75 (41%), Positives = 45/75 (60%) Frame = +3 Query: 3 SISIYTQILRAGLLPDVYTIPLLLKACSQVLAFPQGRSVHGQAIKFALASYIYVNNALIH 182 S YTQ+ RA +LPD + P L++AC+Q+ + G HGQ IK + +YV N+L+H Sbjct: 64 SFHFYTQLFRANILPDYISFPFLVRACAQLESLDMGVQAHGQIIKHGFENNVYVQNSLVH 123 Query: 183 FYSITGNVNDARKLF 227 YS G+V A +F Sbjct: 124 MYSTCGDVTAANAIF 138