BLASTX nr result
ID: Akebia24_contig00045109
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00045109 (323 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006433095.1| hypothetical protein CICLE_v10001604mg [Citr... 58 2e-06 >ref|XP_006433095.1| hypothetical protein CICLE_v10001604mg [Citrus clementina] gi|557535217|gb|ESR46335.1| hypothetical protein CICLE_v10001604mg [Citrus clementina] Length = 363 Score = 57.8 bits (138), Expect = 2e-06 Identities = 34/94 (36%), Positives = 46/94 (48%), Gaps = 16/94 (17%) Frame = +3 Query: 54 QIQMEASRPGKTSLLSSIRWHHKPNSNSHGGHIDNGTNRLNGS----SGNTLHDPNF--- 212 ++Q EAS P + LLS W P+S H GH N G S H P+ Sbjct: 177 KVQTEASLPKRFGLLSPSVWRRSPDSTGHHGHGPGNGNTGYGDYSDKSSKDGHKPSVRNG 236 Query: 213 --------NGNQ-EPTMISTGGWTRPSRLGWAMP 287 NG++ EPT+ ++GGWTRP+R GW +P Sbjct: 237 DYDNYYHNNGSRTEPTVTNSGGWTRPTRAGWGVP 270