BLASTX nr result
ID: Akebia24_contig00045093
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00045093 (339 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI15852.3| unnamed protein product [Vitis vinifera] 79 9e-13 emb|CBI25399.3| unnamed protein product [Vitis vinifera] 75 7e-12 ref|XP_002274158.1| PREDICTED: pentatricopeptide repeat-containi... 69 9e-10 ref|XP_006421546.1| hypothetical protein CICLE_v10004388mg [Citr... 67 2e-09 ref|XP_006490200.1| PREDICTED: pentatricopeptide repeat-containi... 67 3e-09 ref|XP_004160754.1| PREDICTED: pentatricopeptide repeat-containi... 65 1e-08 ref|XP_004138557.1| PREDICTED: pentatricopeptide repeat-containi... 65 1e-08 >emb|CBI15852.3| unnamed protein product [Vitis vinifera] Length = 595 Score = 78.6 bits (192), Expect = 9e-13 Identities = 50/118 (42%), Positives = 68/118 (57%), Gaps = 10/118 (8%) Frame = -1 Query: 324 MVVSFSLKLAISSP---LQCLSPKNDRTRN----SVVTLSSATTQKSHGVLRNKTYPTKT 166 + + S+KL SS L+C SP N + N S TLS + QK GV R K Sbjct: 3 VTLGLSVKLGASSEPSFLRCHSPNNRISNNKAKVSNATLSCSRVQKFKGVGRGKVCDPSY 62 Query: 165 ISKTST---QPQFQALVDLLQDSATKGSIREGETIHGFLIKCNFDGDTSVVLFNHLAH 1 +KT + Q LVDLL+DSA KGSIREG+++HG L+K +F + S+ LFNH+A+ Sbjct: 63 TAKTDRYHESHEAQELVDLLRDSAAKGSIREGKSVHGLLLKSSFGDEESIRLFNHVAY 120 >emb|CBI25399.3| unnamed protein product [Vitis vinifera] Length = 846 Score = 75.5 bits (184), Expect = 7e-12 Identities = 46/109 (42%), Positives = 67/109 (61%), Gaps = 3/109 (2%) Frame = -1 Query: 318 VSFSLKLAISS-PLQCL--SPKNDRTRNSVVTLSSATTQKSHGVLRNKTYPTKTISKTST 148 +SF +KL+ S PL L + N+RT + V++ S T +KS V+ + IS+T Sbjct: 1 MSFFMKLSASQLPLFELPTAVSNNRTGSLAVSVPSQTAKKSKIVVGRNRPESIGISETYQ 60 Query: 147 QPQFQALVDLLQDSATKGSIREGETIHGFLIKCNFDGDTSVVLFNHLAH 1 Q Q Q L+D+L+D A KGSIRE + +HG ++K NF+ +VLFNH AH Sbjct: 61 QTQVQDLIDVLRDCAEKGSIREAKAVHGLVLKSNFEDKDLMVLFNHAAH 109 >ref|XP_002274158.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610-like [Vitis vinifera] Length = 820 Score = 68.6 bits (166), Expect = 9e-10 Identities = 36/84 (42%), Positives = 52/84 (61%) Frame = -1 Query: 252 TRNSVVTLSSATTQKSHGVLRNKTYPTKTISKTSTQPQFQALVDLLQDSATKGSIREGET 73 T + V++ S T +KS V+ + IS+T Q Q Q L+D+L+D A KGSIRE + Sbjct: 80 TGSLAVSVPSQTAKKSKIVVGRNRPESIGISETYQQTQVQDLIDVLRDCAEKGSIREAKA 139 Query: 72 IHGFLIKCNFDGDTSVVLFNHLAH 1 +HG ++K NF+ +VLFNH AH Sbjct: 140 VHGLVLKSNFEDKDLMVLFNHAAH 163 >ref|XP_006421546.1| hypothetical protein CICLE_v10004388mg [Citrus clementina] gi|557523419|gb|ESR34786.1| hypothetical protein CICLE_v10004388mg [Citrus clementina] Length = 762 Score = 67.4 bits (163), Expect = 2e-09 Identities = 37/110 (33%), Positives = 64/110 (58%), Gaps = 2/110 (1%) Frame = -1 Query: 324 MVVSFSLKLAISSPLQCLSP-KNDRTRNSV-VTLSSATTQKSHGVLRNKTYPTKTISKTS 151 M++SF+L+ + S +P N ++R+S V S TTQK + ++ K ++ Sbjct: 1 MILSFNLQFSNLSEFSTPNPISNFKSRSSTAVAFHSQTTQKLNVAIKTKFPILTEANEPQ 60 Query: 150 TQPQFQALVDLLQDSATKGSIREGETIHGFLIKCNFDGDTSVVLFNHLAH 1 + Q Q L+DLL+DS KGS+ +++HGF++K +F ++L NH+AH Sbjct: 61 RKSQIQPLIDLLRDSTNKGSLELAKSLHGFVLKSDFSDKDLLILLNHIAH 110 >ref|XP_006490200.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, chloroplastic-like [Citrus sinensis] Length = 762 Score = 66.6 bits (161), Expect = 3e-09 Identities = 36/110 (32%), Positives = 64/110 (58%), Gaps = 2/110 (1%) Frame = -1 Query: 324 MVVSFSLKLAISSPLQCLSP-KNDRTRNSV-VTLSSATTQKSHGVLRNKTYPTKTISKTS 151 M++SF+L+ + S +P N ++R+S V S TTQK + ++ K ++ Sbjct: 1 MILSFNLQFSNLSEFPTPNPISNFKSRSSTAVAFHSQTTQKLNVAIKTKFPILTEANEPQ 60 Query: 150 TQPQFQALVDLLQDSATKGSIREGETIHGFLIKCNFDGDTSVVLFNHLAH 1 + Q Q L+D+L+DS KGS+ +++HGF++K +F ++L NH+AH Sbjct: 61 RKSQIQPLIDILRDSTNKGSLELAKSVHGFVLKSDFSDKDLLILLNHIAH 110 >ref|XP_004160754.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610-like [Cucumis sativus] Length = 766 Score = 65.1 bits (157), Expect = 1e-08 Identities = 32/83 (38%), Positives = 48/83 (57%) Frame = -1 Query: 249 RNSVVTLSSATTQKSHGVLRNKTYPTKTISKTSTQPQFQALVDLLQDSATKGSIREGETI 70 RNS +T++ + QK KT + + KT + Q Q LVDLL+D +++ +T+ Sbjct: 31 RNSALTITHSAIQKPFATSGIKTPNSVKVDKTDSHLQIQPLVDLLRDCVDARFLKQAKTV 90 Query: 69 HGFLIKCNFDGDTSVVLFNHLAH 1 HGFL+K F S+VL NH+AH Sbjct: 91 HGFLLKSKFSNHHSLVLLNHVAH 113 >ref|XP_004138557.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610-like [Cucumis sativus] Length = 766 Score = 65.1 bits (157), Expect = 1e-08 Identities = 32/83 (38%), Positives = 48/83 (57%) Frame = -1 Query: 249 RNSVVTLSSATTQKSHGVLRNKTYPTKTISKTSTQPQFQALVDLLQDSATKGSIREGETI 70 RNS +T++ + QK KT + + KT + Q Q LVDLL+D +++ +T+ Sbjct: 31 RNSALTITHSAIQKPFATSGIKTPNSVKVDKTDSHLQIQPLVDLLRDCVDARFLKQAKTV 90 Query: 69 HGFLIKCNFDGDTSVVLFNHLAH 1 HGFL+K F S+VL NH+AH Sbjct: 91 HGFLLKSKFSNHHSLVLLNHVAH 113