BLASTX nr result
ID: Akebia24_contig00045018
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00045018 (553 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003602049.1| hypothetical protein MTR_3g088400 [Medicago ... 59 6e-07 ref|XP_002520331.1| conserved hypothetical protein [Ricinus comm... 56 7e-06 >ref|XP_003602049.1| hypothetical protein MTR_3g088400 [Medicago truncatula] gi|357520349|ref|XP_003630463.1| hypothetical protein MTR_8g095810 [Medicago truncatula] gi|355491097|gb|AES72300.1| hypothetical protein MTR_3g088400 [Medicago truncatula] gi|355524485|gb|AET04939.1| hypothetical protein MTR_8g095810 [Medicago truncatula] Length = 169 Score = 59.3 bits (142), Expect = 6e-07 Identities = 26/50 (52%), Positives = 31/50 (62%), Gaps = 4/50 (8%) Frame = -1 Query: 553 DESFNKEGTVPFKWEIRPGTPKPHHHHYQQR----QLTPPPAGSGFSVSP 416 D SF K G+VPFKWEI+PG P PHHHH +L PPP + +SP Sbjct: 6 DYSFKKPGSVPFKWEIKPGLPIPHHHHQNPESPSFKLKPPPQLGSYKLSP 55 >ref|XP_002520331.1| conserved hypothetical protein [Ricinus communis] gi|223540550|gb|EEF42117.1| conserved hypothetical protein [Ricinus communis] Length = 196 Score = 55.8 bits (133), Expect = 7e-06 Identities = 28/47 (59%), Positives = 31/47 (65%) Frame = -1 Query: 553 DESFNKEGTVPFKWEIRPGTPKPHHHHYQQRQLTPPPAGSGFSVSPP 413 D+SF K G VPFKWEIRPG PK HH Q +QL+PP S SPP Sbjct: 4 DDSFKKPGAVPFKWEIRPGVPKIQHHQ-QPKQLSPPKLP---SPSPP 46