BLASTX nr result
ID: Akebia24_contig00044984
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00044984 (257 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002309329.2| hypothetical protein POPTR_0006s14280g [Popu... 60 4e-07 gb|EPS74578.1| hypothetical protein M569_00172 [Genlisea aurea] 60 4e-07 ref|XP_007219140.1| hypothetical protein PRUPE_ppa016001mg, part... 58 1e-06 ref|XP_007206852.1| hypothetical protein PRUPE_ppa027128mg [Prun... 58 1e-06 emb|CAN78447.1| hypothetical protein VITISV_026810 [Vitis vinifera] 57 2e-06 gb|EXB93775.1| hypothetical protein L484_010914 [Morus notabilis] 55 1e-05 emb|CAN66359.1| hypothetical protein VITISV_018312 [Vitis vinifera] 55 1e-05 >ref|XP_002309329.2| hypothetical protein POPTR_0006s14280g [Populus trichocarpa] gi|550336314|gb|EEE92852.2| hypothetical protein POPTR_0006s14280g [Populus trichocarpa] Length = 162 Score = 59.7 bits (143), Expect = 4e-07 Identities = 30/63 (47%), Positives = 41/63 (65%) Frame = -2 Query: 205 FTTSTSLIIMAASFTIPNISHLVSVKLDRSN*ILWISQFLPVLRSHDLIGIVDGSEPCPP 26 F++ST ++ +A+ N+ L+ VK+D N + WISQ LP LRSH L+ VDG EPCP Sbjct: 4 FSSSTPIVFIAS-----NVVQLIWVKMDGENYLNWISQCLPALRSHVLVAFVDGFEPCPE 58 Query: 25 KHL 17 K L Sbjct: 59 KLL 61 >gb|EPS74578.1| hypothetical protein M569_00172 [Genlisea aurea] Length = 219 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/54 (50%), Positives = 39/54 (72%) Frame = -2 Query: 175 AASFTIPNISHLVSVKLDRSN*ILWISQFLPVLRSHDLIGIVDGSEPCPPKHLI 14 +++ T PNI L++V+LD SN + +SQ +PVLR HDL G +DGSE CP + +I Sbjct: 75 SSNLTAPNIFQLITVRLDGSNYLNRVSQIIPVLRCHDLAGFLDGSEVCPAEFMI 128 >ref|XP_007219140.1| hypothetical protein PRUPE_ppa016001mg, partial [Prunus persica] gi|462415602|gb|EMJ20339.1| hypothetical protein PRUPE_ppa016001mg, partial [Prunus persica] Length = 101 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/49 (55%), Positives = 34/49 (69%) Frame = -2 Query: 169 SFTIPNISHLVSVKLDRSN*ILWISQFLPVLRSHDLIGIVDGSEPCPPK 23 SF I NIS +S+KLD N +LW QF+P+L +DL+ VDGS P PPK Sbjct: 10 SFPITNISSHISIKLDSENYLLWRDQFMPLLLGNDLLRYVDGSTPTPPK 58 >ref|XP_007206852.1| hypothetical protein PRUPE_ppa027128mg [Prunus persica] gi|462402494|gb|EMJ08051.1| hypothetical protein PRUPE_ppa027128mg [Prunus persica] Length = 153 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/61 (44%), Positives = 46/61 (75%) Frame = -2 Query: 199 TSTSLIIMAASFTIPNISHLVSVKLDRSN*ILWISQFLPVLRSHDLIGIVDGSEPCPPKH 20 +S+S++I+++S NIS+ +++KLDR+N LW+++ +P+LRSH+L+ VDGS CP Sbjct: 7 SSSSVLIVSSS----NISNFLTIKLDRTNFPLWLAKIVPLLRSHNLLSFVDGSSICPAAF 62 Query: 19 L 17 L Sbjct: 63 L 63 >emb|CAN78447.1| hypothetical protein VITISV_026810 [Vitis vinifera] Length = 1171 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/53 (50%), Positives = 37/53 (69%), Gaps = 1/53 (1%) Frame = -2 Query: 160 IPNISHLVSVKLDRS-N*ILWISQFLPVLRSHDLIGIVDGSEPCPPKHLIAWS 5 +P + ++SVKLD S N + W QFL +LR HDL+G +DG+E CPPKH + S Sbjct: 14 LPPSTTIISVKLDGSHNYLAWKMQFLNLLRGHDLMGFIDGTEACPPKHTASGS 66 >gb|EXB93775.1| hypothetical protein L484_010914 [Morus notabilis] Length = 105 Score = 55.1 bits (131), Expect = 1e-05 Identities = 22/49 (44%), Positives = 34/49 (69%) Frame = -2 Query: 163 TIPNISHLVSVKLDRSN*ILWISQFLPVLRSHDLIGIVDGSEPCPPKHL 17 TIP ++ +S+KLD N +LW +Q L ++ +HD ++DGS PCPP+ L Sbjct: 36 TIPTVNPQLSIKLDDDNFLLWKNQMLNIIIAHDFDDVIDGSRPCPPRFL 84 >emb|CAN66359.1| hypothetical protein VITISV_018312 [Vitis vinifera] Length = 542 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/52 (46%), Positives = 39/52 (75%) Frame = -2 Query: 175 AASFTIPNISHLVSVKLDRSN*ILWISQFLPVLRSHDLIGIVDGSEPCPPKH 20 +A+F +P + ++S+KLD +N + W +Q LP+ RS+ L+GIVDGS P PP++ Sbjct: 8 SATFNLP--AQVISIKLDGTNFLAWSAQLLPLFRSYGLMGIVDGSNPWPPQY 57