BLASTX nr result
ID: Akebia24_contig00044742
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00044742 (275 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525798.1| E3 ubiquitin ligase PUB14, putative [Ricinus... 67 3e-09 ref|XP_006486608.1| PREDICTED: U-box domain-containing protein 1... 64 3e-08 ref|XP_006422439.1| hypothetical protein CICLE_v10028003mg [Citr... 64 3e-08 ref|XP_006384837.1| hypothetical protein POPTR_0004s21490g [Popu... 63 4e-08 ref|XP_004290058.1| PREDICTED: U-box domain-containing protein 1... 62 6e-08 ref|XP_004290057.1| PREDICTED: U-box domain-containing protein 1... 62 6e-08 ref|XP_007041624.1| Plant U-Box 15 isoform 2 [Theobroma cacao] g... 62 1e-07 ref|XP_007041623.1| U-box domain-containing protein 15 isoform 1... 62 1e-07 ref|XP_002313587.2| hypothetical protein POPTR_0009s16740g [Popu... 61 1e-07 emb|CBI37755.3| unnamed protein product [Vitis vinifera] 61 2e-07 ref|XP_002279546.1| PREDICTED: U-box domain-containing protein 1... 61 2e-07 emb|CAN59900.1| hypothetical protein VITISV_002888 [Vitis vinifera] 61 2e-07 gb|EXC31551.1| U-box domain-containing protein 15 [Morus notabilis] 59 5e-07 ref|XP_007199735.1| hypothetical protein PRUPE_ppa002658mg [Prun... 59 5e-07 ref|XP_004154583.1| PREDICTED: LOW QUALITY PROTEIN: U-box domain... 59 7e-07 ref|XP_004140059.1| PREDICTED: U-box domain-containing protein 1... 59 7e-07 ref|XP_002301921.1| hypothetical protein POPTR_0002s01090g [Popu... 57 3e-06 ref|XP_006828720.1| hypothetical protein AMTR_s00001p00030110 [A... 56 5e-06 gb|EYU38026.1| hypothetical protein MIMGU_mgv1a002670mg [Mimulus... 56 6e-06 ref|XP_007221969.1| hypothetical protein PRUPE_ppa002735mg [Prun... 55 8e-06 >ref|XP_002525798.1| E3 ubiquitin ligase PUB14, putative [Ricinus communis] gi|223534885|gb|EEF36572.1| E3 ubiquitin ligase PUB14, putative [Ricinus communis] Length = 655 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -3 Query: 273 QFGVYVHLKEVTRSGTNRAQRKANSLLQHMIKSEHIP 163 Q+GVY HL E+TRSGTNRAQRKANSLLQHM K EHIP Sbjct: 619 QYGVYEHLVEITRSGTNRAQRKANSLLQHMSKCEHIP 655 >ref|XP_006486608.1| PREDICTED: U-box domain-containing protein 15-like [Citrus sinensis] Length = 643 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = -3 Query: 273 QFGVYVHLKEVTRSGTNRAQRKANSLLQHMIKSEHIP 163 Q+GVY HL E+TR GTNR QRKANSLLQHM K EHIP Sbjct: 607 QYGVYEHLVEITRCGTNRGQRKANSLLQHMSKREHIP 643 >ref|XP_006422439.1| hypothetical protein CICLE_v10028003mg [Citrus clementina] gi|557524373|gb|ESR35679.1| hypothetical protein CICLE_v10028003mg [Citrus clementina] Length = 643 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = -3 Query: 273 QFGVYVHLKEVTRSGTNRAQRKANSLLQHMIKSEHIP 163 Q+GVY HL E+TR GTNR QRKANSLLQHM K EHIP Sbjct: 607 QYGVYEHLVEITRCGTNRGQRKANSLLQHMSKREHIP 643 >ref|XP_006384837.1| hypothetical protein POPTR_0004s21490g [Populus trichocarpa] gi|550341605|gb|ERP62634.1| hypothetical protein POPTR_0004s21490g [Populus trichocarpa] Length = 614 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = -3 Query: 273 QFGVYVHLKEVTRSGTNRAQRKANSLLQHMIKSEHIP 163 Q+GVY HL E+T++GTNRAQRKANSLLQHM K EH+P Sbjct: 578 QYGVYEHLAELTKNGTNRAQRKANSLLQHMSKYEHLP 614 >ref|XP_004290058.1| PREDICTED: U-box domain-containing protein 15-like isoform 2 [Fragaria vesca subsp. vesca] Length = 625 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = -3 Query: 273 QFGVYVHLKEVTRSGTNRAQRKANSLLQHMIKSEHIP 163 Q+GVY HL EV R GTNRAQRKAN+LLQHM K EHIP Sbjct: 589 QYGVYEHLVEVARCGTNRAQRKANALLQHMSKCEHIP 625 >ref|XP_004290057.1| PREDICTED: U-box domain-containing protein 15-like isoform 1 [Fragaria vesca subsp. vesca] Length = 650 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = -3 Query: 273 QFGVYVHLKEVTRSGTNRAQRKANSLLQHMIKSEHIP 163 Q+GVY HL EV R GTNRAQRKAN+LLQHM K EHIP Sbjct: 614 QYGVYEHLVEVARCGTNRAQRKANALLQHMSKCEHIP 650 >ref|XP_007041624.1| Plant U-Box 15 isoform 2 [Theobroma cacao] gi|508705559|gb|EOX97455.1| Plant U-Box 15 isoform 2 [Theobroma cacao] Length = 489 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = -3 Query: 273 QFGVYVHLKEVTRSGTNRAQRKANSLLQHMIKSEHIP 163 QFGVY L+E+T +GTNRAQRKANSLLQHM K EHIP Sbjct: 453 QFGVYEPLREITITGTNRAQRKANSLLQHMSKCEHIP 489 >ref|XP_007041623.1| U-box domain-containing protein 15 isoform 1 [Theobroma cacao] gi|508705558|gb|EOX97454.1| U-box domain-containing protein 15 isoform 1 [Theobroma cacao] Length = 633 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = -3 Query: 273 QFGVYVHLKEVTRSGTNRAQRKANSLLQHMIKSEHIP 163 QFGVY L+E+T +GTNRAQRKANSLLQHM K EHIP Sbjct: 597 QFGVYEPLREITITGTNRAQRKANSLLQHMSKCEHIP 633 >ref|XP_002313587.2| hypothetical protein POPTR_0009s16740g [Populus trichocarpa] gi|550331877|gb|EEE87542.2| hypothetical protein POPTR_0009s16740g [Populus trichocarpa] Length = 644 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -3 Query: 273 QFGVYVHLKEVTRSGTNRAQRKANSLLQHMIKSEHIP 163 Q+GVY HL E+T+SGTNRAQRKANS+LQHM K HIP Sbjct: 608 QYGVYEHLVELTKSGTNRAQRKANSILQHMSKYGHIP 644 >emb|CBI37755.3| unnamed protein product [Vitis vinifera] Length = 677 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = -3 Query: 273 QFGVYVHLKEVTRSGTNRAQRKANSLLQHMIKSEHIP 163 Q+GVY HL E+ R GTNRAQRKAN LLQHM K EHIP Sbjct: 598 QYGVYDHLVEIMRCGTNRAQRKANCLLQHMCKCEHIP 634 >ref|XP_002279546.1| PREDICTED: U-box domain-containing protein 15 [Vitis vinifera] Length = 641 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = -3 Query: 273 QFGVYVHLKEVTRSGTNRAQRKANSLLQHMIKSEHIP 163 Q+GVY HL E+ R GTNRAQRKAN LLQHM K EHIP Sbjct: 598 QYGVYDHLVEIMRCGTNRAQRKANCLLQHMCKCEHIP 634 >emb|CAN59900.1| hypothetical protein VITISV_002888 [Vitis vinifera] Length = 639 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = -3 Query: 273 QFGVYVHLKEVTRSGTNRAQRKANSLLQHMIKSEHIP 163 Q+GVY HL E+ R GTNRAQRKAN LLQHM K EHIP Sbjct: 596 QYGVYDHLVEIMRCGTNRAQRKANCLLQHMCKCEHIP 632 >gb|EXC31551.1| U-box domain-containing protein 15 [Morus notabilis] Length = 644 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = -3 Query: 273 QFGVYVHLKEVTRSGTNRAQRKANSLLQHMIKSEHIP 163 QFGVY HL ++ + GT+RAQRKANSLLQHM K EHIP Sbjct: 608 QFGVYEHLVQLAKCGTSRAQRKANSLLQHMSKCEHIP 644 >ref|XP_007199735.1| hypothetical protein PRUPE_ppa002658mg [Prunus persica] gi|462395135|gb|EMJ00934.1| hypothetical protein PRUPE_ppa002658mg [Prunus persica] Length = 647 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/37 (72%), Positives = 30/37 (81%) Frame = -3 Query: 273 QFGVYVHLKEVTRSGTNRAQRKANSLLQHMIKSEHIP 163 Q+GVY HL E+ R GTNR +RKANSLLQHM K EHIP Sbjct: 611 QYGVYEHLLELARCGTNRGKRKANSLLQHMSKCEHIP 647 >ref|XP_004154583.1| PREDICTED: LOW QUALITY PROTEIN: U-box domain-containing protein 15-like [Cucumis sativus] Length = 645 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = -3 Query: 273 QFGVYVHLKEVTRSGTNRAQRKANSLLQHMIKSEHIP 163 QFGVY HL E+TR GT+RAQRKA SLLQ+M K EHIP Sbjct: 609 QFGVYEHLVELTRCGTSRAQRKATSLLQYMSKCEHIP 645 >ref|XP_004140059.1| PREDICTED: U-box domain-containing protein 15-like [Cucumis sativus] Length = 645 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = -3 Query: 273 QFGVYVHLKEVTRSGTNRAQRKANSLLQHMIKSEHIP 163 QFGVY HL E+TR GT+RAQRKA SLLQ+M K EHIP Sbjct: 609 QFGVYEHLVELTRCGTSRAQRKATSLLQYMSKCEHIP 645 >ref|XP_002301921.1| hypothetical protein POPTR_0002s01090g [Populus trichocarpa] gi|222843647|gb|EEE81194.1| hypothetical protein POPTR_0002s01090g [Populus trichocarpa] Length = 639 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = -3 Query: 273 QFGVYVHLKEVTRSGTNRAQRKANSLLQHMIKSEHI 166 QFGVY +L E+++SGTNRAQRKANSLLQ M K+EHI Sbjct: 604 QFGVYENLVEISKSGTNRAQRKANSLLQLMSKAEHI 639 >ref|XP_006828720.1| hypothetical protein AMTR_s00001p00030110 [Amborella trichopoda] gi|548833699|gb|ERM96136.1| hypothetical protein AMTR_s00001p00030110 [Amborella trichopoda] Length = 650 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = -3 Query: 273 QFGVYVHLKEVTRSGTNRAQRKANSLLQHMIKSEHIP 163 QFGVY HL E+ +SG NRAQRKA+SLLQHM K E +P Sbjct: 614 QFGVYEHLIELVQSGNNRAQRKASSLLQHMSKCEQVP 650 >gb|EYU38026.1| hypothetical protein MIMGU_mgv1a002670mg [Mimulus guttatus] Length = 648 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = -3 Query: 273 QFGVYVHLKEVTRSGTNRAQRKANSLLQHMIKSEHIP 163 Q+GVY HL E+TR GT RA+RKANSLL M K+EHIP Sbjct: 607 QYGVYDHLMEITRCGTTRARRKANSLLHLMSKNEHIP 643 >ref|XP_007221969.1| hypothetical protein PRUPE_ppa002735mg [Prunus persica] gi|462418905|gb|EMJ23168.1| hypothetical protein PRUPE_ppa002735mg [Prunus persica] Length = 639 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = -3 Query: 273 QFGVYVHLKEVTRSGTNRAQRKANSLLQHMIKSEHIP 163 QFGVY HL E+T SGTNRAQRKAN+L+Q + K+E IP Sbjct: 603 QFGVYEHLVEITGSGTNRAQRKANALMQLISKTEQIP 639