BLASTX nr result
ID: Akebia24_contig00044053
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00044053 (440 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI28351.3| unnamed protein product [Vitis vinifera] 112 7e-23 ref|XP_002262885.1| PREDICTED: pentatricopeptide repeat-containi... 112 7e-23 ref|XP_002306231.2| hypothetical protein POPTR_0004s19560g [Popu... 106 4e-21 ref|XP_006487970.1| PREDICTED: pentatricopeptide repeat-containi... 105 7e-21 ref|XP_006349117.1| PREDICTED: pentatricopeptide repeat-containi... 105 9e-21 ref|XP_004251045.1| PREDICTED: pentatricopeptide repeat-containi... 105 9e-21 ref|XP_004293078.1| PREDICTED: pentatricopeptide repeat-containi... 104 1e-20 ref|XP_007015858.1| Tetratricopeptide repeat (TPR)-like superfam... 103 3e-20 gb|EYU36955.1| hypothetical protein MIMGU_mgv1a019924mg, partial... 100 2e-19 ref|XP_007207165.1| hypothetical protein PRUPE_ppa023637mg [Prun... 100 2e-19 gb|EPS73842.1| hypothetical protein M569_00905 [Genlisea aurea] 100 4e-19 ref|XP_004296063.1| PREDICTED: pentatricopeptide repeat-containi... 100 4e-19 gb|EMS45170.1| hypothetical protein TRIUR3_26201 [Triticum urartu] 99 6e-19 ref|XP_002961361.1| hypothetical protein SELMODRAFT_76175 [Selag... 99 6e-19 ref|XP_002980913.1| hypothetical protein SELMODRAFT_113567 [Sela... 99 6e-19 ref|XP_006650653.1| PREDICTED: pentatricopeptide repeat-containi... 98 1e-18 ref|XP_007156519.1| hypothetical protein PHAVU_003G292800g [Phas... 98 1e-18 ref|XP_004505212.1| PREDICTED: pentatricopeptide repeat-containi... 98 1e-18 ref|XP_004505209.1| PREDICTED: pentatricopeptide repeat-containi... 98 1e-18 gb|AFK43832.1| unknown [Lotus japonicus] 98 1e-18 >emb|CBI28351.3| unnamed protein product [Vitis vinifera] Length = 770 Score = 112 bits (279), Expect = 7e-23 Identities = 49/54 (90%), Positives = 51/54 (94%) Frame = -1 Query: 440 PRTPLQIVKNLRVCGDCHTVFKLISKMEGRDIVVRDSNRFHHFKEGSCSCGDYW 279 P TP+QIVKNLRVCGDCHTV KLISK+EGRDIVVRDSNRFHHFK GSCSCGDYW Sbjct: 717 PGTPIQIVKNLRVCGDCHTVIKLISKIEGRDIVVRDSNRFHHFKGGSCSCGDYW 770 >ref|XP_002262885.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610-like [Vitis vinifera] Length = 866 Score = 112 bits (279), Expect = 7e-23 Identities = 49/54 (90%), Positives = 51/54 (94%) Frame = -1 Query: 440 PRTPLQIVKNLRVCGDCHTVFKLISKMEGRDIVVRDSNRFHHFKEGSCSCGDYW 279 P TP+QIVKNLRVCGDCHTV KLISK+EGRDIVVRDSNRFHHFK GSCSCGDYW Sbjct: 813 PGTPIQIVKNLRVCGDCHTVIKLISKIEGRDIVVRDSNRFHHFKGGSCSCGDYW 866 >ref|XP_002306231.2| hypothetical protein POPTR_0004s19560g [Populus trichocarpa] gi|550341393|gb|EEE86742.2| hypothetical protein POPTR_0004s19560g [Populus trichocarpa] Length = 732 Score = 106 bits (264), Expect = 4e-21 Identities = 47/54 (87%), Positives = 49/54 (90%) Frame = -1 Query: 440 PRTPLQIVKNLRVCGDCHTVFKLISKMEGRDIVVRDSNRFHHFKEGSCSCGDYW 279 P TPLQIVKNLRVCGDCH+V KLIS +EGRDIVVRDSNRFHHFK G CSCGDYW Sbjct: 679 PGTPLQIVKNLRVCGDCHSVIKLISILEGRDIVVRDSNRFHHFKGGLCSCGDYW 732 >ref|XP_006487970.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610-like [Citrus sinensis] Length = 873 Score = 105 bits (262), Expect = 7e-21 Identities = 46/51 (90%), Positives = 48/51 (94%) Frame = -1 Query: 431 PLQIVKNLRVCGDCHTVFKLISKMEGRDIVVRDSNRFHHFKEGSCSCGDYW 279 PLQIVKNLRVCGDCHTV KLISK+E RDIVVRD+NRFHHFKEG CSCGDYW Sbjct: 823 PLQIVKNLRVCGDCHTVIKLISKLERRDIVVRDTNRFHHFKEGLCSCGDYW 873 >ref|XP_006349117.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610-like [Solanum tuberosum] Length = 871 Score = 105 bits (261), Expect = 9e-21 Identities = 46/54 (85%), Positives = 48/54 (88%) Frame = -1 Query: 440 PRTPLQIVKNLRVCGDCHTVFKLISKMEGRDIVVRDSNRFHHFKEGSCSCGDYW 279 P P+QIVKNLRVCGDCHTV KLISK+EGR IVVRDSNRFHHFK G CSCGDYW Sbjct: 818 PGIPIQIVKNLRVCGDCHTVIKLISKIEGRQIVVRDSNRFHHFKGGLCSCGDYW 871 >ref|XP_004251045.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610-like [Solanum lycopersicum] Length = 871 Score = 105 bits (261), Expect = 9e-21 Identities = 46/54 (85%), Positives = 48/54 (88%) Frame = -1 Query: 440 PRTPLQIVKNLRVCGDCHTVFKLISKMEGRDIVVRDSNRFHHFKEGSCSCGDYW 279 P P+QIVKNLRVCGDCHTV KLISK+EGR IVVRDSNRFHHFK G CSCGDYW Sbjct: 818 PGIPIQIVKNLRVCGDCHTVIKLISKIEGRQIVVRDSNRFHHFKGGLCSCGDYW 871 >ref|XP_004293078.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610-like [Fragaria vesca subsp. vesca] Length = 872 Score = 104 bits (259), Expect = 1e-20 Identities = 44/54 (81%), Positives = 49/54 (90%) Frame = -1 Query: 440 PRTPLQIVKNLRVCGDCHTVFKLISKMEGRDIVVRDSNRFHHFKEGSCSCGDYW 279 PR+P+QI+KNLRVCGDCHTV KLIS +E RDIVVRDSNR+HHFK G CSCGDYW Sbjct: 819 PRSPIQILKNLRVCGDCHTVIKLISVIEARDIVVRDSNRYHHFKNGLCSCGDYW 872 >ref|XP_007015858.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] gi|508786221|gb|EOY33477.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] Length = 875 Score = 103 bits (256), Expect = 3e-20 Identities = 45/54 (83%), Positives = 49/54 (90%) Frame = -1 Query: 440 PRTPLQIVKNLRVCGDCHTVFKLISKMEGRDIVVRDSNRFHHFKEGSCSCGDYW 279 P T LQIVKNLRVCGDCHTV KLIS +EGR+IVVRD+NRFHHF+ GSCSCGDYW Sbjct: 822 PGTALQIVKNLRVCGDCHTVIKLISLIEGREIVVRDTNRFHHFQAGSCSCGDYW 875 >gb|EYU36955.1| hypothetical protein MIMGU_mgv1a019924mg, partial [Mimulus guttatus] Length = 825 Score = 100 bits (249), Expect = 2e-19 Identities = 40/51 (78%), Positives = 47/51 (92%) Frame = -1 Query: 431 PLQIVKNLRVCGDCHTVFKLISKMEGRDIVVRDSNRFHHFKEGSCSCGDYW 279 P++I+KN+RVCGDCH V KLISK+EGR+I+VRDSNRFHHF EG CSCGDYW Sbjct: 775 PIRIIKNIRVCGDCHAVIKLISKLEGREIIVRDSNRFHHFSEGLCSCGDYW 825 >ref|XP_007207165.1| hypothetical protein PRUPE_ppa023637mg [Prunus persica] gi|462402807|gb|EMJ08364.1| hypothetical protein PRUPE_ppa023637mg [Prunus persica] Length = 731 Score = 100 bits (249), Expect = 2e-19 Identities = 43/54 (79%), Positives = 48/54 (88%) Frame = -1 Query: 440 PRTPLQIVKNLRVCGDCHTVFKLISKMEGRDIVVRDSNRFHHFKEGSCSCGDYW 279 P + +QI+KNLRVCGDCHTV KLIS +E RDIVVRDSNRFHHFK+G CSCGDYW Sbjct: 678 PGSTIQILKNLRVCGDCHTVIKLISVIEARDIVVRDSNRFHHFKDGLCSCGDYW 731 >gb|EPS73842.1| hypothetical protein M569_00905 [Genlisea aurea] Length = 826 Score = 99.8 bits (247), Expect = 4e-19 Identities = 41/54 (75%), Positives = 49/54 (90%) Frame = -1 Query: 440 PRTPLQIVKNLRVCGDCHTVFKLISKMEGRDIVVRDSNRFHHFKEGSCSCGDYW 279 P ++++KNLRVCGDCHTV KLI+++EGRDIVVRDSNRFHHF +GSCSCGDYW Sbjct: 773 PGIIVRVIKNLRVCGDCHTVIKLITEIEGRDIVVRDSNRFHHFSKGSCSCGDYW 826 >ref|XP_004296063.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like [Fragaria vesca subsp. vesca] Length = 867 Score = 99.8 bits (247), Expect = 4e-19 Identities = 41/54 (75%), Positives = 49/54 (90%) Frame = -1 Query: 440 PRTPLQIVKNLRVCGDCHTVFKLISKMEGRDIVVRDSNRFHHFKEGSCSCGDYW 279 P+TP++I KNLRVCGDCHTV KLIS + R+I+VRDSNRFHHFK+G+CSCGDYW Sbjct: 814 PKTPIRIFKNLRVCGDCHTVTKLISVITEREIIVRDSNRFHHFKDGTCSCGDYW 867 >gb|EMS45170.1| hypothetical protein TRIUR3_26201 [Triticum urartu] Length = 284 Score = 99.0 bits (245), Expect = 6e-19 Identities = 38/54 (70%), Positives = 49/54 (90%) Frame = -1 Query: 440 PRTPLQIVKNLRVCGDCHTVFKLISKMEGRDIVVRDSNRFHHFKEGSCSCGDYW 279 P TPL+++KNLR+CGDCHT KLI+K+ GR+I+VRD+ RFHHFK+G+CSCGDYW Sbjct: 231 PGTPLRVMKNLRICGDCHTAVKLIAKVTGREIIVRDNKRFHHFKDGACSCGDYW 284 >ref|XP_002961361.1| hypothetical protein SELMODRAFT_76175 [Selaginella moellendorffii] gi|300170020|gb|EFJ36621.1| hypothetical protein SELMODRAFT_76175 [Selaginella moellendorffii] Length = 1121 Score = 99.0 bits (245), Expect = 6e-19 Identities = 41/54 (75%), Positives = 47/54 (87%) Frame = -1 Query: 440 PRTPLQIVKNLRVCGDCHTVFKLISKMEGRDIVVRDSNRFHHFKEGSCSCGDYW 279 P + L+I+KNLR CGDCHT KLIS +EGR+IVVRDSNRFHHF+ GSCSCGDYW Sbjct: 1068 PGSSLRIIKNLRACGDCHTAIKLISAIEGREIVVRDSNRFHHFRNGSCSCGDYW 1121 >ref|XP_002980913.1| hypothetical protein SELMODRAFT_113567 [Selaginella moellendorffii] gi|300151452|gb|EFJ18098.1| hypothetical protein SELMODRAFT_113567 [Selaginella moellendorffii] Length = 809 Score = 99.0 bits (245), Expect = 6e-19 Identities = 41/54 (75%), Positives = 47/54 (87%) Frame = -1 Query: 440 PRTPLQIVKNLRVCGDCHTVFKLISKMEGRDIVVRDSNRFHHFKEGSCSCGDYW 279 P + L+I+KNLR CGDCHT KLIS +EGR+IVVRDSNRFHHF+ GSCSCGDYW Sbjct: 756 PGSSLRIIKNLRACGDCHTAIKLISAIEGREIVVRDSNRFHHFRNGSCSCGDYW 809 >ref|XP_006650653.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14050, mitochondrial-like [Oryza brachyantha] Length = 297 Score = 98.2 bits (243), Expect = 1e-18 Identities = 38/54 (70%), Positives = 48/54 (88%) Frame = -1 Query: 440 PRTPLQIVKNLRVCGDCHTVFKLISKMEGRDIVVRDSNRFHHFKEGSCSCGDYW 279 P TPL+++KNLR+CGDCH KLI+K+ GR+IVVRD+ RFHHFK+G+CSCGDYW Sbjct: 244 PGTPLRVIKNLRICGDCHNAVKLIAKVTGREIVVRDNKRFHHFKDGACSCGDYW 297 >ref|XP_007156519.1| hypothetical protein PHAVU_003G292800g [Phaseolus vulgaris] gi|561029873|gb|ESW28513.1| hypothetical protein PHAVU_003G292800g [Phaseolus vulgaris] Length = 571 Score = 98.2 bits (243), Expect = 1e-18 Identities = 37/54 (68%), Positives = 48/54 (88%) Frame = -1 Query: 440 PRTPLQIVKNLRVCGDCHTVFKLISKMEGRDIVVRDSNRFHHFKEGSCSCGDYW 279 PRTPL+I+KNLRVCGDCH K++S++ GR+++VRD+ RFHHFK+G CSCGDYW Sbjct: 518 PRTPLRIIKNLRVCGDCHNAIKIMSRIVGRELIVRDNKRFHHFKDGKCSCGDYW 571 >ref|XP_004505212.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15690-like [Cicer arietinum] Length = 567 Score = 98.2 bits (243), Expect = 1e-18 Identities = 37/54 (68%), Positives = 48/54 (88%) Frame = -1 Query: 440 PRTPLQIVKNLRVCGDCHTVFKLISKMEGRDIVVRDSNRFHHFKEGSCSCGDYW 279 PRTPL+I+KNLRVCGDCH K++S++ GR+++VRD+ RFHHFK+G CSCGDYW Sbjct: 514 PRTPLRIIKNLRVCGDCHNAIKIMSRIVGRELIVRDNKRFHHFKDGKCSCGDYW 567 >ref|XP_004505209.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15690-like [Cicer arietinum] Length = 567 Score = 98.2 bits (243), Expect = 1e-18 Identities = 37/54 (68%), Positives = 48/54 (88%) Frame = -1 Query: 440 PRTPLQIVKNLRVCGDCHTVFKLISKMEGRDIVVRDSNRFHHFKEGSCSCGDYW 279 PRTPL+I+KNLRVCGDCH K++S++ GR+++VRD+ RFHHFK+G CSCGDYW Sbjct: 514 PRTPLRIIKNLRVCGDCHNAIKIMSRIVGRELIVRDNKRFHHFKDGKCSCGDYW 567 >gb|AFK43832.1| unknown [Lotus japonicus] Length = 295 Score = 98.2 bits (243), Expect = 1e-18 Identities = 37/54 (68%), Positives = 48/54 (88%) Frame = -1 Query: 440 PRTPLQIVKNLRVCGDCHTVFKLISKMEGRDIVVRDSNRFHHFKEGSCSCGDYW 279 PRTPL+I+KNLRVCGDCH K++S++ GR+++VRD+ RFHHFK+G CSCGDYW Sbjct: 242 PRTPLRIIKNLRVCGDCHNAIKIMSRIVGRELIVRDNKRFHHFKDGKCSCGDYW 295