BLASTX nr result
ID: Akebia24_contig00042395
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00042395 (675 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006377155.1| hypothetical protein POPTR_0011s01240g [Popu... 59 2e-06 ref|XP_006376080.1| hypothetical protein POPTR_0013s08970g [Popu... 57 4e-06 ref|XP_006373173.1| hypothetical protein POPTR_0017s09350g [Popu... 56 9e-06 >ref|XP_006377155.1| hypothetical protein POPTR_0011s01240g [Populus trichocarpa] gi|550327298|gb|ERP54952.1| hypothetical protein POPTR_0011s01240g [Populus trichocarpa] Length = 625 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/60 (41%), Positives = 39/60 (65%) Frame = +3 Query: 405 NVEDEIMMAVYLSLWLCCFVLPCEGGDVLHPSTFKVTALIGRGTTVSLVPPLLYCLYKGI 584 +++DE+ +A +LS WLC FV P + + PSTFKV +L+ G SL P+L ++KG+ Sbjct: 206 HIQDEVYLAAFLSCWLCKFVFPSKDVGFIRPSTFKVASLMAAGRQFSLAIPVLASIFKGL 265 >ref|XP_006376080.1| hypothetical protein POPTR_0013s08970g [Populus trichocarpa] gi|550325320|gb|ERP53877.1| hypothetical protein POPTR_0013s08970g [Populus trichocarpa] Length = 334 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/60 (41%), Positives = 40/60 (66%) Frame = +3 Query: 405 NVEDEIMMAVYLSLWLCCFVLPCEGGDVLHPSTFKVTALIGRGTTVSLVPPLLYCLYKGI 584 +++DE+ +A +LS WLC FV P + DV+ STFKV +++ G SL P+L ++KG+ Sbjct: 61 HIQDEVYLAAFLSCWLCKFVFPSKDVDVIRFSTFKVASMMAVGRQFSLAIPVLTSIFKGL 120 >ref|XP_006373173.1| hypothetical protein POPTR_0017s09350g [Populus trichocarpa] gi|550319879|gb|ERP50970.1| hypothetical protein POPTR_0017s09350g [Populus trichocarpa] Length = 946 Score = 56.2 bits (134), Expect = 9e-06 Identities = 24/60 (40%), Positives = 39/60 (65%) Frame = +3 Query: 405 NVEDEIMMAVYLSLWLCCFVLPCEGGDVLHPSTFKVTALIGRGTTVSLVPPLLYCLYKGI 584 +++DE+ +A +LS WLC FV P + + PSTFKV +++ G SL P+L ++KG+ Sbjct: 277 HMQDEVYLAAFLSCWLCKFVFPSKDVGFIRPSTFKVASMMAVGRQFSLAIPVLASIFKGL 336