BLASTX nr result
ID: Akebia24_contig00042393
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00042393 (443 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004248915.1| PREDICTED: transcription factor bHLH84-like ... 58 2e-06 >ref|XP_004248915.1| PREDICTED: transcription factor bHLH84-like [Solanum lycopersicum] Length = 298 Score = 57.8 bits (138), Expect = 2e-06 Identities = 29/39 (74%), Positives = 34/39 (87%), Gaps = 1/39 (2%) Frame = -3 Query: 141 MESMGTMSEGEWSSFSGMS-TEEADFMAQLLGSYSFPSE 28 ME + +MSEG+WSSFSGM TEEADFMAQLLG+ SFP+E Sbjct: 1 MEHVVSMSEGDWSSFSGMCFTEEADFMAQLLGNCSFPNE 39