BLASTX nr result
ID: Akebia24_contig00042187
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00042187 (384 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI25550.3| unnamed protein product [Vitis vinifera] 67 3e-09 gb|EXB66626.1| Ubiquitin carboxyl-terminal hydrolase 22 [Morus n... 60 4e-07 ref|XP_006389427.1| hypothetical protein POPTR_0025s00610g [Popu... 60 4e-07 ref|XP_006453110.1| hypothetical protein CICLE_v10007858mg [Citr... 59 7e-07 ref|XP_007013591.1| Ubiquitin carboxyl-terminal hydrolase isofor... 58 2e-06 ref|XP_007013590.1| Ubiquitin-specific protease 22 isoform 1 [Th... 58 2e-06 ref|XP_007203762.1| hypothetical protein PRUPE_ppa003162mg [Prun... 58 2e-06 ref|XP_004287263.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 57 4e-06 >emb|CBI25550.3| unnamed protein product [Vitis vinifera] Length = 299 Score = 66.6 bits (161), Expect = 3e-09 Identities = 25/39 (64%), Positives = 36/39 (92%) Frame = -1 Query: 117 NHLQQRGQIPQPCPHLADFRSKHGAKPFRSLQQCLKIKP 1 NH + GQIPQPCPHLA++R+++G+KPFR+LQ+CL++KP Sbjct: 25 NHHRINGQIPQPCPHLAEYRTRNGSKPFRALQECLRVKP 63 >gb|EXB66626.1| Ubiquitin carboxyl-terminal hydrolase 22 [Morus notabilis] Length = 600 Score = 59.7 bits (143), Expect = 4e-07 Identities = 22/31 (70%), Positives = 30/31 (96%) Frame = -1 Query: 93 IPQPCPHLADFRSKHGAKPFRSLQQCLKIKP 1 +PQPCPHLA+FRS++G+KPFR+LQ CL++KP Sbjct: 19 LPQPCPHLAEFRSRNGSKPFRALQDCLRVKP 49 >ref|XP_006389427.1| hypothetical protein POPTR_0025s00610g [Populus trichocarpa] gi|550312221|gb|ERP48341.1| hypothetical protein POPTR_0025s00610g [Populus trichocarpa] Length = 587 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/39 (61%), Positives = 29/39 (74%) Frame = -1 Query: 117 NHLQQRGQIPQPCPHLADFRSKHGAKPFRSLQQCLKIKP 1 +H+ IP PCPHLADFRS++G KPF LQ CL+IKP Sbjct: 9 HHINGHDSIPPPCPHLADFRSRNGTKPFHLLQNCLRIKP 47 >ref|XP_006453110.1| hypothetical protein CICLE_v10007858mg [Citrus clementina] gi|568840886|ref|XP_006474396.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 22-like [Citrus sinensis] gi|557556336|gb|ESR66350.1| hypothetical protein CICLE_v10007858mg [Citrus clementina] Length = 572 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/44 (63%), Positives = 33/44 (75%), Gaps = 5/44 (11%) Frame = -1 Query: 117 NHLQQR----GQI-PQPCPHLADFRSKHGAKPFRSLQQCLKIKP 1 NH Q GQI PQPCPHLADFR+++G KPFR++Q CL IKP Sbjct: 6 NHHHQNDKTNGQIFPQPCPHLADFRARNGTKPFRAIQDCLHIKP 49 >ref|XP_007013591.1| Ubiquitin carboxyl-terminal hydrolase isoform 2 [Theobroma cacao] gi|508783954|gb|EOY31210.1| Ubiquitin carboxyl-terminal hydrolase isoform 2 [Theobroma cacao] Length = 592 Score = 57.8 bits (138), Expect = 2e-06 Identities = 22/34 (64%), Positives = 31/34 (91%), Gaps = 1/34 (2%) Frame = -1 Query: 99 GQI-PQPCPHLADFRSKHGAKPFRSLQQCLKIKP 1 GQ+ PQPCPH+ DFRS++G+KPFR+LQ C+++KP Sbjct: 7 GQVSPQPCPHILDFRSRNGSKPFRALQDCIRVKP 40 >ref|XP_007013590.1| Ubiquitin-specific protease 22 isoform 1 [Theobroma cacao] gi|508783953|gb|EOY31209.1| Ubiquitin-specific protease 22 isoform 1 [Theobroma cacao] Length = 640 Score = 57.8 bits (138), Expect = 2e-06 Identities = 22/34 (64%), Positives = 31/34 (91%), Gaps = 1/34 (2%) Frame = -1 Query: 99 GQI-PQPCPHLADFRSKHGAKPFRSLQQCLKIKP 1 GQ+ PQPCPH+ DFRS++G+KPFR+LQ C+++KP Sbjct: 7 GQVSPQPCPHILDFRSRNGSKPFRALQDCIRVKP 40 >ref|XP_007203762.1| hypothetical protein PRUPE_ppa003162mg [Prunus persica] gi|462399293|gb|EMJ04961.1| hypothetical protein PRUPE_ppa003162mg [Prunus persica] Length = 597 Score = 57.8 bits (138), Expect = 2e-06 Identities = 21/31 (67%), Positives = 29/31 (93%) Frame = -1 Query: 93 IPQPCPHLADFRSKHGAKPFRSLQQCLKIKP 1 +P PCPHLA+FR+K+G+KPFR+LQ CL++KP Sbjct: 19 LPHPCPHLAEFRAKNGSKPFRALQDCLRVKP 49 >ref|XP_004287263.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 22-like [Fragaria vesca subsp. vesca] Length = 574 Score = 56.6 bits (135), Expect = 4e-06 Identities = 22/30 (73%), Positives = 27/30 (90%) Frame = -1 Query: 90 PQPCPHLADFRSKHGAKPFRSLQQCLKIKP 1 P PCPHLA F+SK+G+KPFR+LQ CL+IKP Sbjct: 13 PHPCPHLASFKSKNGSKPFRALQDCLRIKP 42