BLASTX nr result
ID: Akebia24_contig00041735
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00041735 (249 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMF09217.1| thioredoxin [Sphaerulina musiva SO2202] 93 4e-17 gb|EME78407.1| hypothetical protein MYCFIDRAFT_205026 [Pseudocer... 92 1e-16 gb|EMD69924.1| hypothetical protein COCSADRAFT_77303 [Bipolaris ... 91 2e-16 gb|EKG13018.1| Thioredoxin [Macrophomina phaseolina MS6] 91 2e-16 gb|EON61097.1| hypothetical protein W97_00308 [Coniosporium apol... 89 6e-16 gb|EMC91960.1| hypothetical protein BAUCODRAFT_39110 [Baudoinia ... 89 8e-16 gb|EUC31311.1| hypothetical protein COCCADRAFT_38558 [Bipolaris ... 88 1e-15 ref|XP_007585614.1| putative thioredoxin protein [Neofusicoccum ... 88 1e-15 gb|EMD86195.1| hypothetical protein COCHEDRAFT_1228264 [Bipolari... 88 1e-15 gb|EOA87142.1| hypothetical protein SETTUDRAFT_163157 [Setosphae... 87 2e-15 ref|XP_003303420.1| hypothetical protein PTT_15618 [Pyrenophora ... 87 2e-15 ref|XP_001939504.1| thioredoxin [Pyrenophora tritici-repentis Pt... 87 2e-15 gb|EXJ74742.1| thioredoxin 1 [Cladophialophora psammophila CBS 1... 87 2e-15 gb|EUC45458.1| hypothetical protein COCMIDRAFT_95543 [Bipolaris ... 87 2e-15 ref|XP_003837113.1| hypothetical protein LEMA_P033470.1 [Leptosp... 86 4e-15 gb|EHK98740.1| putative Thioredoxin [Glarea lozoyensis 74030] gi... 85 9e-15 gb|EXJ94520.1| thioredoxin 1 [Capronia coronata CBS 617.96] 84 2e-14 gb|ETI21314.1| thioredoxin [Cladophialophora carrionii CBS 160.54] 84 2e-14 ref|XP_001799253.1| hypothetical protein SNOG_08948 [Phaeosphaer... 84 2e-14 gb|AAQ87932.1| Cop c 2-like protein [Curvularia lunata] 84 2e-14 >gb|EMF09217.1| thioredoxin [Sphaerulina musiva SO2202] Length = 107 Score = 92.8 bits (229), Expect = 4e-17 Identities = 45/54 (83%), Positives = 49/54 (90%) Frame = +3 Query: 6 AKFYKIDVDEVPDVAQELSVRAMPTFFLFKNGEKIAEVVGANPNALKAAIEKGL 167 AKFYKIDVDE+P+VAQEL+VRAMPTF LFKNG K+ EVVGANP ALKAAIEK L Sbjct: 54 AKFYKIDVDELPEVAQELAVRAMPTFLLFKNGHKVGEVVGANPPALKAAIEKAL 107 >gb|EME78407.1| hypothetical protein MYCFIDRAFT_205026 [Pseudocercospora fijiensis CIRAD86] Length = 107 Score = 91.7 bits (226), Expect = 1e-16 Identities = 44/54 (81%), Positives = 49/54 (90%) Frame = +3 Query: 6 AKFYKIDVDEVPDVAQELSVRAMPTFFLFKNGEKIAEVVGANPNALKAAIEKGL 167 A+FYKIDVDE PDVAQELSVRAMPTFFLFKNGEK+ EVVGANP AL+ AI++ L Sbjct: 54 ARFYKIDVDECPDVAQELSVRAMPTFFLFKNGEKVGEVVGANPAALETAIKQNL 107 >gb|EMD69924.1| hypothetical protein COCSADRAFT_77303 [Bipolaris sorokiniana ND90Pr] Length = 158 Score = 90.5 bits (223), Expect = 2e-16 Identities = 42/54 (77%), Positives = 49/54 (90%) Frame = +3 Query: 6 AKFYKIDVDEVPDVAQELSVRAMPTFFLFKNGEKIAEVVGANPNALKAAIEKGL 167 A+FYK+DVDEVPDVAQEL +RAMPTFFLFK G+K+AEVVGANP AL+AAI+ L Sbjct: 104 ARFYKLDVDEVPDVAQELGIRAMPTFFLFKGGDKVAEVVGANPKALEAAIKANL 157 >gb|EKG13018.1| Thioredoxin [Macrophomina phaseolina MS6] Length = 107 Score = 90.5 bits (223), Expect = 2e-16 Identities = 43/52 (82%), Positives = 47/52 (90%) Frame = +3 Query: 6 AKFYKIDVDEVPDVAQELSVRAMPTFFLFKNGEKIAEVVGANPNALKAAIEK 161 AKFYK+DVDEVPDVAQEL +RAMPTF LFK GEK+ EVVGANP AL+AAIEK Sbjct: 51 AKFYKLDVDEVPDVAQELGIRAMPTFLLFKGGEKVDEVVGANPKALQAAIEK 102 >gb|EON61097.1| hypothetical protein W97_00308 [Coniosporium apollinis CBS 100218] Length = 110 Score = 89.0 bits (219), Expect = 6e-16 Identities = 41/54 (75%), Positives = 48/54 (88%) Frame = +3 Query: 6 AKFYKIDVDEVPDVAQELSVRAMPTFFLFKNGEKIAEVVGANPNALKAAIEKGL 167 A+FYK+DVDEVP+VAQEL +RAMPTF LFKNGEK+ EVVGANP AL+AAI+ L Sbjct: 55 ARFYKLDVDEVPEVAQELGIRAMPTFLLFKNGEKVGEVVGANPKALEAAIKSNL 108 >gb|EMC91960.1| hypothetical protein BAUCODRAFT_39110 [Baudoinia compniacensis UAMH 10762] Length = 108 Score = 88.6 bits (218), Expect = 8e-16 Identities = 41/54 (75%), Positives = 49/54 (90%) Frame = +3 Query: 6 AKFYKIDVDEVPDVAQELSVRAMPTFFLFKNGEKIAEVVGANPNALKAAIEKGL 167 A+FYK+DVDEVP+VAQEL+VRAMPTF LFKNGEK+ EVVGANP+AL+ AI+ L Sbjct: 55 ARFYKLDVDEVPEVAQELAVRAMPTFLLFKNGEKVGEVVGANPSALETAIKSNL 108 >gb|EUC31311.1| hypothetical protein COCCADRAFT_38558 [Bipolaris zeicola 26-R-13] gi|578486808|gb|EUN24276.1| hypothetical protein COCVIDRAFT_106528 [Bipolaris victoriae FI3] Length = 158 Score = 88.2 bits (217), Expect = 1e-15 Identities = 41/54 (75%), Positives = 48/54 (88%) Frame = +3 Query: 6 AKFYKIDVDEVPDVAQELSVRAMPTFFLFKNGEKIAEVVGANPNALKAAIEKGL 167 A+FYK+DVDEVPDVAQEL +RAMPTF LFK G+K+AEVVGANP AL+AAI+ L Sbjct: 104 ARFYKLDVDEVPDVAQELGIRAMPTFLLFKGGDKVAEVVGANPKALEAAIKANL 157 >ref|XP_007585614.1| putative thioredoxin protein [Neofusicoccum parvum UCRNP2] gi|485921102|gb|EOD46908.1| putative thioredoxin protein [Neofusicoccum parvum UCRNP2] Length = 107 Score = 88.2 bits (217), Expect = 1e-15 Identities = 41/52 (78%), Positives = 47/52 (90%) Frame = +3 Query: 6 AKFYKIDVDEVPDVAQELSVRAMPTFFLFKNGEKIAEVVGANPNALKAAIEK 161 AKFYK+DVDEVPDVAQEL +RAMPTF LFK GEK+ EVVGANP AL+AAI++ Sbjct: 52 AKFYKLDVDEVPDVAQELGIRAMPTFLLFKGGEKVGEVVGANPKALEAAIKQ 103 >gb|EMD86195.1| hypothetical protein COCHEDRAFT_1228264 [Bipolaris maydis C5] gi|477589067|gb|ENI06144.1| hypothetical protein COCC4DRAFT_135611 [Bipolaris maydis ATCC 48331] Length = 110 Score = 88.2 bits (217), Expect = 1e-15 Identities = 41/54 (75%), Positives = 48/54 (88%) Frame = +3 Query: 6 AKFYKIDVDEVPDVAQELSVRAMPTFFLFKNGEKIAEVVGANPNALKAAIEKGL 167 A+FYK+DVDEVPDVAQEL +RAMPTF LFK G+K+AEVVGANP AL+AAI+ L Sbjct: 56 ARFYKLDVDEVPDVAQELGIRAMPTFLLFKGGDKVAEVVGANPKALEAAIKANL 109 >gb|EOA87142.1| hypothetical protein SETTUDRAFT_163157 [Setosphaeria turcica Et28A] Length = 157 Score = 87.4 bits (215), Expect = 2e-15 Identities = 40/55 (72%), Positives = 48/55 (87%) Frame = +3 Query: 3 QAKFYKIDVDEVPDVAQELSVRAMPTFFLFKNGEKIAEVVGANPNALKAAIEKGL 167 +A+FYK+DVDEVPDVAQEL +RAMPTF LFK G K+AEVVGANP AL+AAI+ + Sbjct: 102 KARFYKLDVDEVPDVAQELGIRAMPTFLLFKGGNKVAEVVGANPKALEAAIQANI 156 >ref|XP_003303420.1| hypothetical protein PTT_15618 [Pyrenophora teres f. teres 0-1] gi|311320594|gb|EFQ88475.1| hypothetical protein PTT_15618 [Pyrenophora teres f. teres 0-1] Length = 158 Score = 87.4 bits (215), Expect = 2e-15 Identities = 40/54 (74%), Positives = 47/54 (87%) Frame = +3 Query: 6 AKFYKIDVDEVPDVAQELSVRAMPTFFLFKNGEKIAEVVGANPNALKAAIEKGL 167 A+FYKIDVDEVPDVAQEL +RAMPTF FK G+K+AEVVGANP AL+AAI+ + Sbjct: 104 ARFYKIDVDEVPDVAQELGIRAMPTFLFFKGGDKVAEVVGANPKALEAAIQSNI 157 >ref|XP_001939504.1| thioredoxin [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187975597|gb|EDU42223.1| thioredoxin [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 111 Score = 87.4 bits (215), Expect = 2e-15 Identities = 40/54 (74%), Positives = 47/54 (87%) Frame = +3 Query: 6 AKFYKIDVDEVPDVAQELSVRAMPTFFLFKNGEKIAEVVGANPNALKAAIEKGL 167 A+FYKIDVDEVPDVAQEL +RAMPTF FK G+K+AEVVGANP AL+AAI+ + Sbjct: 57 ARFYKIDVDEVPDVAQELGIRAMPTFLFFKGGDKVAEVVGANPKALEAAIQSNI 110 >gb|EXJ74742.1| thioredoxin 1 [Cladophialophora psammophila CBS 110553] Length = 141 Score = 87.0 bits (214), Expect = 2e-15 Identities = 41/52 (78%), Positives = 46/52 (88%) Frame = +3 Query: 12 FYKIDVDEVPDVAQELSVRAMPTFFLFKNGEKIAEVVGANPNALKAAIEKGL 167 FYK+DVDEVPDVAQEL VRAMPTF +FKNGEK+ EVVGAN +AL+AAI K L Sbjct: 90 FYKVDVDEVPDVAQELGVRAMPTFMIFKNGEKVGEVVGANKHALEAAIRKNL 141 >gb|EUC45458.1| hypothetical protein COCMIDRAFT_95543 [Bipolaris oryzae ATCC 44560] Length = 158 Score = 87.0 bits (214), Expect = 2e-15 Identities = 40/54 (74%), Positives = 48/54 (88%) Frame = +3 Query: 6 AKFYKIDVDEVPDVAQELSVRAMPTFFLFKNGEKIAEVVGANPNALKAAIEKGL 167 A+FYK+DVD+VPDVAQEL +RAMPTF LFK G+K+AEVVGANP AL+AAI+ L Sbjct: 104 ARFYKLDVDDVPDVAQELGIRAMPTFLLFKGGDKVAEVVGANPKALEAAIKANL 157 >ref|XP_003837113.1| hypothetical protein LEMA_P033470.1 [Leptosphaeria maculans JN3] gi|312213671|emb|CBX93673.1| hypothetical protein LEMA_P033470.1 [Leptosphaeria maculans JN3] Length = 210 Score = 86.3 bits (212), Expect = 4e-15 Identities = 40/51 (78%), Positives = 47/51 (92%) Frame = +3 Query: 6 AKFYKIDVDEVPDVAQELSVRAMPTFFLFKNGEKIAEVVGANPNALKAAIE 158 A+F+K+DVDEVPDVAQEL +RAMPTF LFK G+KIAEVVGANP AL+AAI+ Sbjct: 156 ARFFKLDVDEVPDVAQELGIRAMPTFLLFKGGDKIAEVVGANPKALEAAIQ 206 >gb|EHK98740.1| putative Thioredoxin [Glarea lozoyensis 74030] gi|512199513|gb|EPE28346.1| Thioredoxin-like protein [Glarea lozoyensis ATCC 20868] Length = 106 Score = 85.1 bits (209), Expect = 9e-15 Identities = 40/50 (80%), Positives = 45/50 (90%) Frame = +3 Query: 12 FYKIDVDEVPDVAQELSVRAMPTFFLFKNGEKIAEVVGANPNALKAAIEK 161 F KIDVDEVPDVAQEL +RAMPTF +FK+GEK+ EVVGANP ALKAAI+K Sbjct: 53 FVKIDVDEVPDVAQELGIRAMPTFLIFKDGEKVQEVVGANPQALKAAIDK 102 >gb|EXJ94520.1| thioredoxin 1 [Capronia coronata CBS 617.96] Length = 159 Score = 84.0 bits (206), Expect = 2e-14 Identities = 41/48 (85%), Positives = 43/48 (89%) Frame = +3 Query: 12 FYKIDVDEVPDVAQELSVRAMPTFFLFKNGEKIAEVVGANPNALKAAI 155 FYKIDVDEVPDVAQEL VRAMPTF LFKNGEK+AEVVGAN AL+ AI Sbjct: 108 FYKIDVDEVPDVAQELGVRAMPTFMLFKNGEKVAEVVGANKKALEQAI 155 >gb|ETI21314.1| thioredoxin [Cladophialophora carrionii CBS 160.54] Length = 141 Score = 84.0 bits (206), Expect = 2e-14 Identities = 40/50 (80%), Positives = 44/50 (88%) Frame = +3 Query: 12 FYKIDVDEVPDVAQELSVRAMPTFFLFKNGEKIAEVVGANPNALKAAIEK 161 FYK+DVDEVPDVAQEL VRAMPTF FKNGEK+ EVVGAN AL+AAI+K Sbjct: 90 FYKVDVDEVPDVAQELGVRAMPTFMFFKNGEKVDEVVGANVRALEAAIQK 139 >ref|XP_001799253.1| hypothetical protein SNOG_08948 [Phaeosphaeria nodorum SN15] gi|111062996|gb|EAT84116.1| hypothetical protein SNOG_08948 [Phaeosphaeria nodorum SN15] Length = 159 Score = 84.0 bits (206), Expect = 2e-14 Identities = 35/53 (66%), Positives = 46/53 (86%) Frame = +3 Query: 3 QAKFYKIDVDEVPDVAQELSVRAMPTFFLFKNGEKIAEVVGANPNALKAAIEK 161 + +FYK+D+DEVPD+AQEL +RAMPTF FKNGEK+ EVVGANP A++A I++ Sbjct: 103 ETRFYKLDIDEVPDIAQELGIRAMPTFVFFKNGEKVGEVVGANPKAIEAGIQE 155 >gb|AAQ87932.1| Cop c 2-like protein [Curvularia lunata] Length = 112 Score = 84.0 bits (206), Expect = 2e-14 Identities = 38/51 (74%), Positives = 47/51 (92%) Frame = +3 Query: 6 AKFYKIDVDEVPDVAQELSVRAMPTFFLFKNGEKIAEVVGANPNALKAAIE 158 A+F+K+DVD+VPDVAQEL +RAMPTF LFK G+KI+EVVGANP AL+AAI+ Sbjct: 58 ARFFKLDVDDVPDVAQELGIRAMPTFLLFKGGDKISEVVGANPKALEAAIQ 108