BLASTX nr result
ID: Akebia24_contig00041681
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00041681 (242 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002279589.1| PREDICTED: pentatricopeptide repeat-containi... 100 4e-19 ref|XP_006384843.1| hypothetical protein POPTR_0004s21560g [Popu... 95 1e-17 ref|XP_007041612.1| Pentatricopeptide repeat (PPR) superfamily p... 92 7e-17 ref|XP_007041611.1| Pentatricopeptide repeat (PPR) superfamily p... 92 7e-17 gb|EXC31542.1| hypothetical protein L484_006574 [Morus notabilis] 89 8e-16 ref|XP_004290060.1| PREDICTED: pentatricopeptide repeat-containi... 87 2e-15 ref|XP_006486600.1| PREDICTED: pentatricopeptide repeat-containi... 86 4e-15 ref|XP_006422433.1| hypothetical protein CICLE_v10027787mg [Citr... 86 4e-15 ref|XP_002527150.1| pentatricopeptide repeat-containing protein,... 85 1e-14 ref|XP_002884041.1| binding protein [Arabidopsis lyrata subsp. l... 84 2e-14 ref|XP_006409347.1| hypothetical protein EUTSA_v10022542mg [Eutr... 80 2e-13 ref|XP_006296960.1| hypothetical protein CARUB_v10012952mg, part... 80 3e-13 ref|XP_004154721.1| PREDICTED: pentatricopeptide repeat-containi... 80 3e-13 ref|XP_004144886.1| PREDICTED: pentatricopeptide repeat-containi... 80 3e-13 ref|NP_179305.2| pentatricopeptide repeat-containing protein [Ar... 78 1e-12 ref|XP_007200313.1| hypothetical protein PRUPE_ppa001249mg [Prun... 77 2e-12 ref|XP_004231526.1| PREDICTED: pentatricopeptide repeat-containi... 77 3e-12 ref|XP_006350361.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 76 4e-12 gb|EYU38033.1| hypothetical protein MIMGU_mgv1a026472mg [Mimulus... 71 2e-10 ref|XP_003530995.1| PREDICTED: pentatricopeptide repeat-containi... 70 2e-10 >ref|XP_002279589.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17140 [Vitis vinifera] gi|297744485|emb|CBI37747.3| unnamed protein product [Vitis vinifera] Length = 878 Score = 99.8 bits (247), Expect = 4e-19 Identities = 48/80 (60%), Positives = 61/80 (76%) Frame = +3 Query: 3 NILHKMIDKGHEFDPASFMPVIDALGKQGSKHESDNLAERMMEMASEGRVKNRKYHKGYG 182 +ILHKMIDKG+ FDPASFMPVID LGK+G KH++D LAERMM+MASEG V+N+ Sbjct: 758 DILHKMIDKGYRFDPASFMPVIDGLGKRGKKHDADELAERMMDMASEGMVENK-----IT 812 Query: 183 EKESNGKKRRKGHFSGSNWQ 242 ES ++++ FSGS+WQ Sbjct: 813 RNESAFNRQKRNKFSGSDWQ 832 >ref|XP_006384843.1| hypothetical protein POPTR_0004s21560g [Populus trichocarpa] gi|550341611|gb|ERP62640.1| hypothetical protein POPTR_0004s21560g [Populus trichocarpa] Length = 874 Score = 94.7 bits (234), Expect = 1e-17 Identities = 48/79 (60%), Positives = 58/79 (73%) Frame = +3 Query: 6 ILHKMIDKGHEFDPASFMPVIDALGKQGSKHESDNLAERMMEMASEGRVKNRKYHKGYGE 185 ILHK+IDKG+ FDPASFMPVID LGK+G+KHE+D LAE+MMEMASEG+VKN+ + Sbjct: 755 ILHKLIDKGYWFDPASFMPVIDGLGKRGNKHEADELAEKMMEMASEGKVKNKVHQN--AS 812 Query: 186 KESNGKKRRKGHFSGSNWQ 242 GKK + G S WQ Sbjct: 813 CSIQGKKNKDGE---SEWQ 828 >ref|XP_007041612.1| Pentatricopeptide repeat (PPR) superfamily protein isoform 2 [Theobroma cacao] gi|508705547|gb|EOX97443.1| Pentatricopeptide repeat (PPR) superfamily protein isoform 2 [Theobroma cacao] Length = 632 Score = 92.0 bits (227), Expect = 7e-17 Identities = 46/79 (58%), Positives = 60/79 (75%) Frame = +3 Query: 6 ILHKMIDKGHEFDPASFMPVIDALGKQGSKHESDNLAERMMEMASEGRVKNRKYHKGYGE 185 ILHKMI+KG++FDPA+FMPV+D LGK+G+KHE+D LAE+MMEMAS+GRV N+ Y Sbjct: 513 ILHKMINKGYKFDPATFMPVVDELGKRGNKHEADELAEKMMEMASDGRVGNKIY---LNA 569 Query: 186 KESNGKKRRKGHFSGSNWQ 242 +E +K K F G +WQ Sbjct: 570 REPIHRKEIK--FGGDDWQ 586 >ref|XP_007041611.1| Pentatricopeptide repeat (PPR) superfamily protein isoform 1 [Theobroma cacao] gi|508705546|gb|EOX97442.1| Pentatricopeptide repeat (PPR) superfamily protein isoform 1 [Theobroma cacao] Length = 872 Score = 92.0 bits (227), Expect = 7e-17 Identities = 46/79 (58%), Positives = 60/79 (75%) Frame = +3 Query: 6 ILHKMIDKGHEFDPASFMPVIDALGKQGSKHESDNLAERMMEMASEGRVKNRKYHKGYGE 185 ILHKMI+KG++FDPA+FMPV+D LGK+G+KHE+D LAE+MMEMAS+GRV N+ Y Sbjct: 753 ILHKMINKGYKFDPATFMPVVDELGKRGNKHEADELAEKMMEMASDGRVGNKIY---LNA 809 Query: 186 KESNGKKRRKGHFSGSNWQ 242 +E +K K F G +WQ Sbjct: 810 REPIHRKEIK--FGGDDWQ 826 >gb|EXC31542.1| hypothetical protein L484_006574 [Morus notabilis] Length = 864 Score = 88.6 bits (218), Expect = 8e-16 Identities = 46/80 (57%), Positives = 60/80 (75%) Frame = +3 Query: 3 NILHKMIDKGHEFDPASFMPVIDALGKQGSKHESDNLAERMMEMASEGRVKNRKYHKGYG 182 +I++ M+ KG+ FDPASFMPVID LGK+G+KHE++ LAERMMEM+SEGRVKN+ Y Sbjct: 748 SIIYYMLGKGYGFDPASFMPVIDGLGKKGNKHEAELLAERMMEMSSEGRVKNKVYRH--- 804 Query: 183 EKESNGKKRRKGHFSGSNWQ 242 EKE + +RR S+WQ Sbjct: 805 EKEMS--QRRSRQTDKSDWQ 822 >ref|XP_004290060.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17140-like [Fragaria vesca subsp. vesca] Length = 871 Score = 87.0 bits (214), Expect = 2e-15 Identities = 44/80 (55%), Positives = 59/80 (73%) Frame = +3 Query: 3 NILHKMIDKGHEFDPASFMPVIDALGKQGSKHESDNLAERMMEMASEGRVKNRKYHKGYG 182 +ILH M++KG+ FD ASF+PVID LGK+G+KHE+D LAERMMEMASEGR+ N+ Y Sbjct: 757 SILHNMMNKGYGFDSASFLPVIDGLGKKGNKHEADELAERMMEMASEGRIANKVYR---S 813 Query: 183 EKESNGKKRRKGHFSGSNWQ 242 +++ G K + GS+WQ Sbjct: 814 QRDIIG---GKPYSCGSDWQ 830 >ref|XP_006486600.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17140-like [Citrus sinensis] gi|568866524|ref|XP_006486605.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17140-like [Citrus sinensis] Length = 889 Score = 86.3 bits (212), Expect = 4e-15 Identities = 45/79 (56%), Positives = 58/79 (73%) Frame = +3 Query: 6 ILHKMIDKGHEFDPASFMPVIDALGKQGSKHESDNLAERMMEMASEGRVKNRKYHKGYGE 185 I++KMIDKG+ FDPASFMPVIDALG++G KHE+D LAE+MMEM S+GRV + K + GE Sbjct: 758 IIYKMIDKGYGFDPASFMPVIDALGERGKKHEADELAEKMMEMTSDGRVAH-KISQNAGE 816 Query: 186 KESNGKKRRKGHFSGSNWQ 242 +R++ GS WQ Sbjct: 817 L----VRRKQNKNGGSVWQ 831 >ref|XP_006422433.1| hypothetical protein CICLE_v10027787mg [Citrus clementina] gi|557524367|gb|ESR35673.1| hypothetical protein CICLE_v10027787mg [Citrus clementina] Length = 889 Score = 86.3 bits (212), Expect = 4e-15 Identities = 45/79 (56%), Positives = 58/79 (73%) Frame = +3 Query: 6 ILHKMIDKGHEFDPASFMPVIDALGKQGSKHESDNLAERMMEMASEGRVKNRKYHKGYGE 185 I++KMIDKG+ FDPASFMPVIDALG++G KHE+D LAE+MMEM S+GRV + K + GE Sbjct: 758 IIYKMIDKGYGFDPASFMPVIDALGERGKKHEADELAEKMMEMTSDGRVAH-KISQNAGE 816 Query: 186 KESNGKKRRKGHFSGSNWQ 242 +R++ GS WQ Sbjct: 817 L----VRRKQNKNGGSVWQ 831 >ref|XP_002527150.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223533489|gb|EEF35232.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 874 Score = 84.7 bits (208), Expect = 1e-14 Identities = 41/79 (51%), Positives = 54/79 (68%) Frame = +3 Query: 3 NILHKMIDKGHEFDPASFMPVIDALGKQGSKHESDNLAERMMEMASEGRVKNRKYHKGYG 182 ++LH++IDKG++FDPASFMPVID GK G+KH +D LAERMMEMASE +N+ Y G Sbjct: 754 DVLHRLIDKGYQFDPASFMPVIDGFGKMGNKHVADELAERMMEMASESNKENKAYPNVKG 813 Query: 183 EKESNGKKRRKGHFSGSNW 239 R K +G++W Sbjct: 814 H-----ILRNKNKDAGNDW 827 >ref|XP_002884041.1| binding protein [Arabidopsis lyrata subsp. lyrata] gi|297329881|gb|EFH60300.1| binding protein [Arabidopsis lyrata subsp. lyrata] Length = 874 Score = 84.0 bits (206), Expect = 2e-14 Identities = 41/79 (51%), Positives = 55/79 (69%) Frame = +3 Query: 6 ILHKMIDKGHEFDPASFMPVIDALGKQGSKHESDNLAERMMEMASEGRVKNRKYHKGYGE 185 ILHKMIDKG+ FDPA+ MPVID LGK G+K E++N AE+MMEMAS G V N+ Sbjct: 755 ILHKMIDKGYGFDPAALMPVIDGLGKMGNKKEANNFAEKMMEMASVGEVANK-----VDP 809 Query: 186 KESNGKKRRKGHFSGSNWQ 242 ++ +++ +SG+NWQ Sbjct: 810 NATDIHQKKHNKYSGNNWQ 828 >ref|XP_006409347.1| hypothetical protein EUTSA_v10022542mg [Eutrema salsugineum] gi|557110509|gb|ESQ50800.1| hypothetical protein EUTSA_v10022542mg [Eutrema salsugineum] Length = 877 Score = 80.5 bits (197), Expect = 2e-13 Identities = 41/79 (51%), Positives = 52/79 (65%) Frame = +3 Query: 6 ILHKMIDKGHEFDPASFMPVIDALGKQGSKHESDNLAERMMEMASEGRVKNRKYHKGYGE 185 ILHKMIDKG+ FDPA+ MPVID LGK G+K E++N AE+MMEMAS G V N+ Sbjct: 758 ILHKMIDKGYGFDPAALMPVIDGLGKMGNKTEANNFAEKMMEMASVGEVANKVDLNARDL 817 Query: 186 KESNGKKRRKGHFSGSNWQ 242 ++ K + G+NWQ Sbjct: 818 HQTKDNK-----YGGNNWQ 831 >ref|XP_006296960.1| hypothetical protein CARUB_v10012952mg, partial [Capsella rubella] gi|482565669|gb|EOA29858.1| hypothetical protein CARUB_v10012952mg, partial [Capsella rubella] Length = 881 Score = 80.1 bits (196), Expect = 3e-13 Identities = 42/79 (53%), Positives = 54/79 (68%) Frame = +3 Query: 6 ILHKMIDKGHEFDPASFMPVIDALGKQGSKHESDNLAERMMEMASEGRVKNRKYHKGYGE 185 ILHKMIDKG+ FDPA+ MPVID LGK G+K E++N AE+MMEMAS G V N+ Sbjct: 762 ILHKMIDKGYGFDPAALMPVIDGLGKMGNKKEANNFAEKMMEMASVGEVANK---VDPNA 818 Query: 186 KESNGKKRRKGHFSGSNWQ 242 ++ + KK + G+NWQ Sbjct: 819 RDLHQKKHTR--HGGNNWQ 835 >ref|XP_004154721.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17140-like [Cucumis sativus] Length = 875 Score = 80.1 bits (196), Expect = 3e-13 Identities = 42/79 (53%), Positives = 51/79 (64%) Frame = +3 Query: 6 ILHKMIDKGHEFDPASFMPVIDALGKQGSKHESDNLAERMMEMASEGRVKNRKYHKGYGE 185 ILHKM+DK + FDPASFMPVID LGK+GSKH +D AERMMEMASE + E Sbjct: 760 ILHKMMDKQYSFDPASFMPVIDELGKRGSKHAADEFAERMMEMASE---------TDFNE 810 Query: 186 KESNGKKRRKGHFSGSNWQ 242 E+ + R + S+WQ Sbjct: 811 HENKNIRGRLNNNDESDWQ 829 >ref|XP_004144886.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17140-like [Cucumis sativus] gi|449472527|ref|XP_004153621.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17140-like [Cucumis sativus] Length = 875 Score = 80.1 bits (196), Expect = 3e-13 Identities = 42/79 (53%), Positives = 51/79 (64%) Frame = +3 Query: 6 ILHKMIDKGHEFDPASFMPVIDALGKQGSKHESDNLAERMMEMASEGRVKNRKYHKGYGE 185 ILHKM+DK + FDPASFMPVID LGK+GSKH +D AERMMEMASE + E Sbjct: 760 ILHKMMDKQYSFDPASFMPVIDELGKRGSKHAADEFAERMMEMASE---------TDFNE 810 Query: 186 KESNGKKRRKGHFSGSNWQ 242 E+ + R + S+WQ Sbjct: 811 HENKNIRGRLNNNDESDWQ 829 >ref|NP_179305.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|122223754|sp|Q0WPZ6.1|PP158_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At2g17140 gi|110737729|dbj|BAF00803.1| hypothetical protein [Arabidopsis thaliana] gi|330251496|gb|AEC06590.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 874 Score = 77.8 bits (190), Expect = 1e-12 Identities = 40/79 (50%), Positives = 54/79 (68%) Frame = +3 Query: 6 ILHKMIDKGHEFDPASFMPVIDALGKQGSKHESDNLAERMMEMASEGRVKNRKYHKGYGE 185 ILHKMID+G+ FDPA+ MPVID LGK G+K E+++ A++MMEMAS G V N+ Sbjct: 755 ILHKMIDRGYGFDPAALMPVIDGLGKMGNKKEANSFADKMMEMASVGEVANK---VDPNA 811 Query: 186 KESNGKKRRKGHFSGSNWQ 242 ++ + KK K G+NWQ Sbjct: 812 RDIHQKKHNKN--GGNNWQ 828 >ref|XP_007200313.1| hypothetical protein PRUPE_ppa001249mg [Prunus persica] gi|462395713|gb|EMJ01512.1| hypothetical protein PRUPE_ppa001249mg [Prunus persica] Length = 872 Score = 77.0 bits (188), Expect = 2e-12 Identities = 42/80 (52%), Positives = 55/80 (68%) Frame = +3 Query: 3 NILHKMIDKGHEFDPASFMPVIDALGKQGSKHESDNLAERMMEMASEGRVKNRKYHKGYG 182 +ILH M +KG+ FDPASF+PVID L K+G+K E+D LAE MM+M SEGRV ++ Y Sbjct: 757 SILHTMKNKGYGFDPASFLPVIDGLSKRGNKQEADELAEAMMDMESEGRVGDKVYRI--- 813 Query: 183 EKESNGKKRRKGHFSGSNWQ 242 E+E G K + GS+WQ Sbjct: 814 EREIIGGK--PSNNGGSDWQ 831 >ref|XP_004231526.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17140-like [Solanum lycopersicum] Length = 837 Score = 76.6 bits (187), Expect = 3e-12 Identities = 42/80 (52%), Positives = 51/80 (63%) Frame = +3 Query: 3 NILHKMIDKGHEFDPASFMPVIDALGKQGSKHESDNLAERMMEMASEGRVKNRKYHKGYG 182 +IL KM+ G+ FDPASFMPVID L K G KH +D L ERM+EM SEG+V N+ Y Sbjct: 735 DILIKMMHIGYGFDPASFMPVIDGLIKLGQKHVADELTERMLEMVSEGKVGNKTYQ---N 791 Query: 183 EKESNGKKRRKGHFSGSNWQ 242 +E N KR K + G WQ Sbjct: 792 YRELNHMKRSK--YGGDGWQ 809 >ref|XP_006350361.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At2g17140-like [Solanum tuberosum] Length = 849 Score = 76.3 bits (186), Expect = 4e-12 Identities = 41/80 (51%), Positives = 51/80 (63%) Frame = +3 Query: 3 NILHKMIDKGHEFDPASFMPVIDALGKQGSKHESDNLAERMMEMASEGRVKNRKYHKGYG 182 +IL KM+ G+ FDPASFMPVID L K G KH +D L+ERM+EM SE +V N+ Y Sbjct: 734 DILIKMMHIGYGFDPASFMPVIDGLNKLGQKHVADELSERMLEMVSESKVGNKAYQ---N 790 Query: 183 EKESNGKKRRKGHFSGSNWQ 242 +E N KR K + G WQ Sbjct: 791 YRELNHMKRSK--YGGDGWQ 808 >gb|EYU38033.1| hypothetical protein MIMGU_mgv1a026472mg [Mimulus guttatus] Length = 869 Score = 70.9 bits (172), Expect = 2e-10 Identities = 37/80 (46%), Positives = 54/80 (67%) Frame = +3 Query: 3 NILHKMIDKGHEFDPASFMPVIDALGKQGSKHESDNLAERMMEMASEGRVKNRKYHKGYG 182 ++L KM+ +G FDPA FMPVID LG++G+KHE + L ERM+ M+SE ++N + G Sbjct: 752 DLLKKMLQRGCRFDPALFMPVIDYLGRRGNKHEVNELTERMLAMSSEVEIENNVHID--G 809 Query: 183 EKESNGKKRRKGHFSGSNWQ 242 +K ++ KK G GS+WQ Sbjct: 810 KKLNHSKKYSDG---GSDWQ 826 >ref|XP_003530995.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17140-like isoform X1 [Glycine max] Length = 875 Score = 70.5 bits (171), Expect = 2e-10 Identities = 38/80 (47%), Positives = 54/80 (67%) Frame = +3 Query: 3 NILHKMIDKGHEFDPASFMPVIDALGKQGSKHESDNLAERMMEMASEGRVKNRKYHKGYG 182 ++L+K+IDKG+ FD ASFMPVID L K+G+K ++D LA+RMME+ E R +R Y Sbjct: 755 SLLYKLIDKGYGFDHASFMPVIDGLSKRGNKRQADELAKRMMELELEDRPVDRTYSN--R 812 Query: 183 EKESNGKKRRKGHFSGSNWQ 242 ++ GK + G GS+WQ Sbjct: 813 KRVIPGKLLKDG---GSDWQ 829