BLASTX nr result
ID: Akebia24_contig00041633
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00041633 (474 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI34458.3| unnamed protein product [Vitis vinifera] 55 1e-05 ref|XP_002271107.1| PREDICTED: uncharacterized protein LOC100243... 55 1e-05 >emb|CBI34458.3| unnamed protein product [Vitis vinifera] Length = 712 Score = 55.1 bits (131), Expect = 1e-05 Identities = 22/36 (61%), Positives = 29/36 (80%), Gaps = 1/36 (2%) Frame = +3 Query: 3 VRCPKCDSILP-LPDVPFYKCGGCGVILKGKQWKPS 107 VRCPKC+++LP LPD P Y+CGGCG +L+ K+ PS Sbjct: 10 VRCPKCENLLPELPDYPVYQCGGCGAVLRAKKKAPS 45 >ref|XP_002271107.1| PREDICTED: uncharacterized protein LOC100243335 [Vitis vinifera] Length = 956 Score = 55.1 bits (131), Expect = 1e-05 Identities = 22/36 (61%), Positives = 29/36 (80%), Gaps = 1/36 (2%) Frame = +3 Query: 3 VRCPKCDSILP-LPDVPFYKCGGCGVILKGKQWKPS 107 VRCPKC+++LP LPD P Y+CGGCG +L+ K+ PS Sbjct: 10 VRCPKCENLLPELPDYPVYQCGGCGAVLRAKKKAPS 45