BLASTX nr result
ID: Akebia24_contig00041597
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00041597 (536 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007201674.1| hypothetical protein PRUPE_ppa022498mg [Prun... 71 1e-10 >ref|XP_007201674.1| hypothetical protein PRUPE_ppa022498mg [Prunus persica] gi|462397074|gb|EMJ02873.1| hypothetical protein PRUPE_ppa022498mg [Prunus persica] Length = 996 Score = 71.2 bits (173), Expect = 1e-10 Identities = 39/110 (35%), Positives = 67/110 (60%), Gaps = 2/110 (1%) Frame = +3 Query: 207 CERIRHVRHLEKNSELLKIKKERLYSVRDAMKDEMHRGLMQGKIPTAECRTWFEALEDIE 386 C+ I ++ LE+N ELL E LYS+RD + +E+ + LM GK PT +C+ W E + +IE Sbjct: 16 CQPIGRLKRLERNFELLIQITECLYSMRDTINEEVTKELMWGKAPTLKCKKWLEKVGEIE 75 Query: 387 DHVHDIEVEFKHKRRFLRGMCPDLSLHMNLG--ERVANLIDEISIHLEKS 530 D V+D+ ++ DL +H ++G + + +++++I+ HLEKS Sbjct: 76 DQVNDM--------LKIQETSSDLVIHSHVGLHQHLMSMLNKITDHLEKS 117