BLASTX nr result
ID: Akebia24_contig00040566
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00040566 (262 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002280019.1| PREDICTED: uncharacterized protein LOC100262... 63 5e-08 emb|CBI37643.3| unnamed protein product [Vitis vinifera] 63 5e-08 ref|XP_002521721.1| conserved hypothetical protein [Ricinus comm... 57 2e-06 ref|XP_007046506.1| Transducin/WD40 repeat-like superfamily prot... 57 3e-06 ref|XP_007046505.1| Transducin/WD40 repeat-like superfamily prot... 57 3e-06 ref|XP_007046504.1| Transducin/WD40 repeat-like superfamily prot... 57 3e-06 ref|XP_007046503.1| Transducin/WD40 repeat-like superfamily prot... 57 3e-06 ref|XP_007204792.1| hypothetical protein PRUPE_ppa017381mg, part... 56 5e-06 >ref|XP_002280019.1| PREDICTED: uncharacterized protein LOC100262676 [Vitis vinifera] Length = 1053 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = -3 Query: 119 GGNLNGLKSNDLNPRLVFHYGIPAESLALAYDSIQKLLA 3 GG+L+GLKS D++PRLVFHYGIP S+ AYDSIQK+LA Sbjct: 15 GGSLDGLKSQDVDPRLVFHYGIPGGSILFAYDSIQKILA 53 >emb|CBI37643.3| unnamed protein product [Vitis vinifera] Length = 1054 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = -3 Query: 119 GGNLNGLKSNDLNPRLVFHYGIPAESLALAYDSIQKLLA 3 GG+L+GLKS D++PRLVFHYGIP S+ AYDSIQK+LA Sbjct: 15 GGSLDGLKSQDVDPRLVFHYGIPGGSILFAYDSIQKILA 53 >ref|XP_002521721.1| conserved hypothetical protein [Ricinus communis] gi|223539112|gb|EEF40708.1| conserved hypothetical protein [Ricinus communis] Length = 995 Score = 57.4 bits (137), Expect = 2e-06 Identities = 31/59 (52%), Positives = 37/59 (62%), Gaps = 2/59 (3%) Frame = -3 Query: 173 HQPCNSTFTEV*RYPHLS--GGNLNGLKSNDLNPRLVFHYGIPAESLALAYDSIQKLLA 3 H P S R HL GGNL LKS+++ PRL FHYGIP+ + AYDSIQK+LA Sbjct: 5 HGPTGSAVLAWLRCHHLPVPGGNLERLKSSEVEPRLAFHYGIPSGANMFAYDSIQKILA 63 >ref|XP_007046506.1| Transducin/WD40 repeat-like superfamily protein isoform 4 [Theobroma cacao] gi|508698767|gb|EOX90663.1| Transducin/WD40 repeat-like superfamily protein isoform 4 [Theobroma cacao] Length = 1011 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/39 (64%), Positives = 32/39 (82%) Frame = -3 Query: 119 GGNLNGLKSNDLNPRLVFHYGIPAESLALAYDSIQKLLA 3 GGN +GLK++D++P +VFHYGIP LAYDSIQK+LA Sbjct: 15 GGNSDGLKASDVDPHMVFHYGIPLGCCMLAYDSIQKILA 53 >ref|XP_007046505.1| Transducin/WD40 repeat-like superfamily protein isoform 3 [Theobroma cacao] gi|508698766|gb|EOX90662.1| Transducin/WD40 repeat-like superfamily protein isoform 3 [Theobroma cacao] Length = 1016 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/39 (64%), Positives = 32/39 (82%) Frame = -3 Query: 119 GGNLNGLKSNDLNPRLVFHYGIPAESLALAYDSIQKLLA 3 GGN +GLK++D++P +VFHYGIP LAYDSIQK+LA Sbjct: 15 GGNSDGLKASDVDPHMVFHYGIPLGCCMLAYDSIQKILA 53 >ref|XP_007046504.1| Transducin/WD40 repeat-like superfamily protein isoform 2 [Theobroma cacao] gi|508698765|gb|EOX90661.1| Transducin/WD40 repeat-like superfamily protein isoform 2 [Theobroma cacao] Length = 1026 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/39 (64%), Positives = 32/39 (82%) Frame = -3 Query: 119 GGNLNGLKSNDLNPRLVFHYGIPAESLALAYDSIQKLLA 3 GGN +GLK++D++P +VFHYGIP LAYDSIQK+LA Sbjct: 15 GGNSDGLKASDVDPHMVFHYGIPLGCCMLAYDSIQKILA 53 >ref|XP_007046503.1| Transducin/WD40 repeat-like superfamily protein isoform 1 [Theobroma cacao] gi|508698764|gb|EOX90660.1| Transducin/WD40 repeat-like superfamily protein isoform 1 [Theobroma cacao] Length = 1052 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/39 (64%), Positives = 32/39 (82%) Frame = -3 Query: 119 GGNLNGLKSNDLNPRLVFHYGIPAESLALAYDSIQKLLA 3 GGN +GLK++D++P +VFHYGIP LAYDSIQK+LA Sbjct: 15 GGNSDGLKASDVDPHMVFHYGIPLGCCMLAYDSIQKILA 53 >ref|XP_007204792.1| hypothetical protein PRUPE_ppa017381mg, partial [Prunus persica] gi|462400323|gb|EMJ05991.1| hypothetical protein PRUPE_ppa017381mg, partial [Prunus persica] Length = 1035 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/39 (61%), Positives = 32/39 (82%) Frame = -3 Query: 119 GGNLNGLKSNDLNPRLVFHYGIPAESLALAYDSIQKLLA 3 GGN +GLK +D++PRL+FHYGIP+ LAYD +QK+LA Sbjct: 2 GGNSDGLKGSDIDPRLLFHYGIPSGCNMLAYDPVQKILA 40