BLASTX nr result
ID: Akebia24_contig00040442
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00040442 (273 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN75833.1| hypothetical protein VITISV_039637 [Vitis vinifera] 59 7e-07 >emb|CAN75833.1| hypothetical protein VITISV_039637 [Vitis vinifera] Length = 1281 Score = 58.9 bits (141), Expect = 7e-07 Identities = 30/45 (66%), Positives = 35/45 (77%) Frame = -2 Query: 137 VSFVWFCFCQIDWRERKKGAFMHLSLWKPISHCASLIMDKKSRRR 3 VS + + F +ID K+ A MHLSLWKPISHCASLIMDKKSRR+ Sbjct: 326 VSTIQWWFQEID---SKREALMHLSLWKPISHCASLIMDKKSRRK 367